[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50005.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:111 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->41 PF00038 * Filament 0.00079 34.4 32/312  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50005.1 GT:GENE ABO50005.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1602061..1602396) GB:FROM 1602061 GB:TO 1602396 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO50005.1 GB:DB_XREF GI:134052034 LENGTH 111 SQ:AASEQ MMVSQFITTNQLETLTRQQRRDLERKYQKKLHSLQRLTSKSELPISFDNNSVTAYGNFGILEAFKQAIDFKGILKGVSLKRHHNCKYSDTGLLDTIIDALSFYSQCFVRKI GT:EXON 1|1-111:0| HM:PFM:NREP 1 HM:PFM:REP 10->41|PF00038|0.00079|34.4|32/312|Filament| OP:NHOMO 15 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------F--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,17-26| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEccccEEEEccHHHHHHHHHHHcHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcc //