[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50010.1
DDBJ      :             camphor resistance protein CrcB
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  62/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:127 amino acids
:PSIPRED
:RPS:PFM   4->109 PF02537 * CRCB 6e-11 45.7 %
:HMM:PFM   4->113 PF02537 * CRCB 1.3e-34 52.3 109/117  
:BLT:SWISS 6->109 CRCB2_BACCR 9e-22 45.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50010.1 GT:GENE ABO50010.1 GT:PRODUCT camphor resistance protein CrcB GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1604982..1605365) GB:FROM 1604982 GB:TO 1605365 GB:DIRECTION - GB:PRODUCT camphor resistance protein CrcB GB:NOTE TIGRFAM: CrcB protein PFAM: Camphor resistance CrcB protein KEGG: bce:BC5068 CrcB family protein GB:PROTEIN_ID ABO50010.1 GB:DB_XREF GI:134052039 InterPro:IPR003691 LENGTH 127 SQ:AASEQ MKAIFLVAAGGFLGAIGRFYLSNRIQSKQNTDFPIGTFTVNLLGSLLLGLLAGQSVDPSLYLLVGTGFLGAFTTFSTFELEAVELLRKNKVKLSLFYLLGSVMLGVLCAFLGYSLSKSYSFLLFISS GT:EXON 1|1-127:0| BL:SWS:NREP 1 BL:SWS:REP 6->109|CRCB2_BACCR|9e-22|45.2|104/118| TM:NTM 3 TM:REGION 1->23| TM:REGION 43->65| TM:REGION 98->120| SEG 42->53|llgslllgllag| SEG 110->126|flgyslsksysfllfis| RP:PFM:NREP 1 RP:PFM:REP 4->109|PF02537|6e-11|45.7|105/115|CRCB| HM:PFM:NREP 1 HM:PFM:REP 4->113|PF02537|1.3e-34|52.3|109/117|CRCB| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF02537|IPR003691| OP:NHOMO 68 OP:NHOMOORG 66 OP:PATTERN ---1----------------------------------------------111--------------- --1---------------------------------------------------------------------111-----1----1-----1--------1-1-------------------------1--11----------------1--2-1--------------1------------------------111111111111111------1-1-111---111111-----------------------------------------------------------------------------------------------1-------------11------------1---21-----1--------------------------------11--1--------------------11--------------------------------1-----------------------------------------------------------------------------------------------1---------------------------1---------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------1-1--------------------------1------------------------------------------------------------------------------------------------------1----------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //