Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50018.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:82 amino acids
:HMM:PFM   10->51 PF01667 * Ribosomal_S27e 0.00017 33.3 39/55  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50018.1 GT:GENE ABO50018.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1611037..1611285 GB:FROM 1611037 GB:TO 1611285 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO50018.1 GB:DB_XREF GI:134052047 LENGTH 82 SQ:AASEQ MEKRSVEHFQCPACYSKAFRFTCPDEVQCCICGSTGKLEAENTPAKIKIKQSDLENHFWTLAHRQHHLEGWMEESKQTKLLG GT:EXON 1|1-82:0| HM:PFM:NREP 1 HM:PFM:REP 10->51|PF01667|0.00017|33.3|39/55|Ribosomal_S27e| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,82-83| PSIPRED cccccHHHHcccHHHHHHEEEccccccEEEEEcccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //