[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50023.1
DDBJ      :             3-hydroxyacyl-CoA dehydrogenase
Swiss-Prot:             

Homologs  Archaea  36/68 : Bacteria  564/915 : Eukaryota  164/199 : Viruses  0/175   --->[See Alignment]
a.100.1c.2.1
:284 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->283 3hadB PDBj 4e-61 43.1 %
:RPS:PDB   4->65 2aejB PDBj 3e-06 9.7 %
:RPS:PDB   51->284 1e9yA PDBj 1e-41 15.6 %
:RPS:SCOP  1->179 1evyA2  c.2.1.6 * 4e-22 9.2 %
:RPS:SCOP  186->283 1f0yA1  a.100.1.3 * 8e-36 44.9 %
:HMM:SCOP  1->185 1f0yA2 c.2.1.6 * 1.8e-64 50.3 %
:HMM:SCOP  185->284 1wdkA1 a.100.1.3 * 6e-35 55.1 %
:RPS:PFM   5->184 PF02737 * 3HCDH_N 2e-48 53.9 %
:RPS:PFM   186->280 PF00725 * 3HCDH 2e-29 57.9 %
:HMM:PFM   5->183 PF02737 * 3HCDH_N 3.3e-71 50.8 179/180  
:HMM:PFM   186->282 PF00725 * 3HCDH 3.7e-38 51.5 97/97  
:BLT:SWISS 3->284 HBD_CLOAB 2e-90 57.8 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50023.1 GT:GENE ABO50023.1 GT:PRODUCT 3-hydroxyacyl-CoA dehydrogenase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1616022..1616876) GB:FROM 1616022 GB:TO 1616876 GB:DIRECTION - GB:PRODUCT 3-hydroxyacyl-CoA dehydrogenase GB:NOTE PFAM: 3-hydroxyacyl-CoA dehydrogenase domain protein; 3-hydroxyacyl-CoA dehydrogenase, NAD-binding KEGG: chy:CHY_1292 3-hydroxybutyryl-CoA dehydrogenase GB:PROTEIN_ID ABO50023.1 GB:DB_XREF GI:134052052 InterPro:IPR006108 InterPro:IPR006176 LENGTH 284 SQ:AASEQ MNIKKIAVLGSGTMGSGIAQVAAQSGYEVLLIDVDQKFIDRALAGISKGFQKAVDKGKMTAEDKEQVFGRIKGSISYEDCKDVDLVIEAILENMDLKKQVYKQLDEKCPDHAILASNTSSLSITEMAAATKRSDKVVGMHFFNPAQVMKLVEVIPGLDTSEETIAAITEVAKKMNKVPVNAKESPGFIVNRILVPMINEAVIALGEGIGTIEEIDTAMKLGAGMPMGPLALADMVGIDIVLAVAEVFYKEFADSKYRPALLLKQMVRAGHLGVKTGRGFYSYQK GT:EXON 1|1-284:0| BL:SWS:NREP 1 BL:SWS:REP 3->284|HBD_CLOAB|2e-90|57.8|282/282| TM:NTM 2 TM:REGION 6->28| TM:REGION 227->249| BL:PDB:NREP 1 BL:PDB:REP 3->283|3hadB|4e-61|43.1|281/291| RP:PDB:NREP 2 RP:PDB:REP 4->65|2aejB|3e-06|9.7|62/220| RP:PDB:REP 51->284|1e9yA|1e-41|15.6|224/238| RP:PFM:NREP 2 RP:PFM:REP 5->184|PF02737|2e-48|53.9|180/180|3HCDH_N| RP:PFM:REP 186->280|PF00725|2e-29|57.9|95/97|3HCDH| HM:PFM:NREP 2 HM:PFM:REP 5->183|PF02737|3.3e-71|50.8|179/180|3HCDH_N| HM:PFM:REP 186->282|PF00725|3.7e-38|51.5|97/97|3HCDH| GO:PFM:NREP 4 GO:PFM GO:0006631|"GO:fatty acid metabolic process"|PF02737|IPR006176| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF02737|IPR006176| GO:PFM GO:0006631|"GO:fatty acid metabolic process"|PF00725|IPR006108| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00725|IPR006108| RP:SCP:NREP 2 RP:SCP:REP 1->179|1evyA2|4e-22|9.2|173/189|c.2.1.6| RP:SCP:REP 186->283|1f0yA1|8e-36|44.9|98/99|a.100.1.3| HM:SCP:REP 1->185|1f0yA2|1.8e-64|50.3|185/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 185->284|1wdkA1|6e-35|55.1|98/125|a.100.1.3|1/1|6-phosphogluconate dehydrogenase C-terminal domain-like| OP:NHOMO 2370 OP:NHOMOORG 764 OP:PATTERN 11-1--4655655544-111121A5223112411---------------------------2331-11 243391-4--123263333-322237333333332356AA245522221311323434--447-7569982-----1111-14---------1-11---3-232252432------------------------1-11111---311--1-------------------1-------------33322---3222222222332232222422322223443321------53111111111111111211-2--1----1-----11---1-------1111---------------------------------------2-1122111111111211222111-1-314112-651417-24---1--1-4-16332-----336553223333434443343444-22722825763-433233433344572223474343448--------4---1342-------------1----1--11-1----12282-49848887888556668866666657B7E59672355455555655686113----23-------1119542845-1---------44414-21-33335412---------------------------22-321224322222222222223222223---22--------3222-223223333243-233322242322222322344422322222222222222222251222222--222222222222---2111113333-2422111--------1---55535333326-66654653454574112111111111-222222222222222222222223------11111111--------1---------------------------------------- ----115-631-222243253346756111111111122222211111246555112224441--------------------------12141113222222222-5A4B7644553333355323649V4-555323234372244324346345375993C635536-8B722231H1112245A42333363334 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 284 STR:RPRED 100.0 SQ:SECSTR HHHHEEEEEcccHHHHHHHHHHHHTTccEEEEcccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHTcccccHHHHHHHHHHHHHHTcccHHHHHHHGGGcccTTTccTTHHHHccEEEEEEEETTEEEEEEEEcccccccccTTccccccccTTTTccccEEEEEEcccccEEEETTccGGccTTEEccGGGGHHHHHTTTTEEEcccTTcEETHEEcTTcEEEEEEEEccTTcEEccTTccccEEcHHHHHHHHHHHHHHTcTTcccccccccccc DISOP:02AL 1-1,53-64,284-285| PSIPRED ccEEEEEEEcccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccHHHHccccEEEEEccccHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHccccHHHEEEEccccccccccEEEEEEcccccHHHHHHHHHHHHHHccEEEEEEccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHcccccEEcccccEEccc //