[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50032.1
DDBJ      :             molybdopterin dehydrogenase, FAD-binding
Swiss-Prot:             

Homologs  Archaea  18/68 : Bacteria  167/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.145.1d.87.2
:287 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->286 1n5wF PDBj 1e-19 29.4 %
:RPS:PDB   5->282 2ckjA PDBj 1e-23 13.1 %
:RPS:SCOP  4->112 1rm6B2  d.145.1.3 * 5e-18 30.2 %
:RPS:SCOP  177->282 1fiqB1  d.87.2.1 * 4e-19 12.3 %
:HMM:SCOP  3->175 1rm6B2 d.145.1.3 * 3.5e-39 35.5 %
:HMM:SCOP  176->286 1n62C1 d.87.2.1 * 7.4e-25 38.5 %
:RPS:PFM   5->172 PF00941 * FAD_binding_5 4e-17 30.7 %
:RPS:PFM   183->282 PF03450 * CO_deh_flav_C 2e-10 40.4 %
:HMM:PFM   4->169 PF00941 * FAD_binding_5 5.7e-40 36.0 164/171  
:HMM:PFM   180->282 PF03450 * CO_deh_flav_C 2.1e-26 37.6 101/103  
:BLT:SWISS 24->286 XDHB_ECO57 1e-25 27.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50032.1 GT:GENE ABO50032.1 GT:PRODUCT molybdopterin dehydrogenase, FAD-binding GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1630455..1631318 GB:FROM 1630455 GB:TO 1631318 GB:DIRECTION + GB:PRODUCT molybdopterin dehydrogenase, FAD-binding GB:NOTE PFAM: molybdopterin dehydrogenase, FAD-binding; CO dehydrogenase flavoprotein domain protein KEGG: dps:DP2533 similar to aerobic-type carbon monoxide dehydrogenase, medium subunit GB:PROTEIN_ID ABO50032.1 GB:DB_XREF GI:134052061 InterPro:IPR002346 InterPro:IPR005107 LENGTH 287 SQ:AASEQ MLKDYVLAKSVDDVLAELNTYAGKARIIAGGSDAMLDLNSGKLKTDCLIDITKIGELKKIDYMDGQIVIGAAVTHSEVKNSELIKTKAPLLSDASGSVGSLQIRNTATVVGNVLNAQPAADAAVALVALGAEAEIKDMTGTVYVPVEEMYAGVGKSTVDSTKQLVTAVKFSALVEGQGSAFVRLAQRGALALPMLNVAVVISLKEEKVEWVRIVMAPVAPKPIRARMAEKVLQNASVSEELIEEAARVACTEANPRNSALRGSAEYRKEVLEVLVKRALEQAISAAR GT:EXON 1|1-287:0| BL:SWS:NREP 1 BL:SWS:REP 24->286|XDHB_ECO57|1e-25|27.1|262/292| SEG 113->133|vlnaqpaadaavalvalgaea| BL:PDB:NREP 1 BL:PDB:REP 4->286|1n5wF|1e-19|29.4|279/286| RP:PDB:NREP 1 RP:PDB:REP 5->282|2ckjA|1e-23|13.1|275/1264| RP:PFM:NREP 2 RP:PFM:REP 5->172|PF00941|4e-17|30.7|166/171|FAD_binding_5| RP:PFM:REP 183->282|PF03450|2e-10|40.4|99/102|CO_deh_flav_C| HM:PFM:NREP 2 HM:PFM:REP 4->169|PF00941|5.7e-40|36.0|164/171|FAD_binding_5| HM:PFM:REP 180->282|PF03450|2.1e-26|37.6|101/103|CO_deh_flav_C| GO:PFM:NREP 2 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00941|IPR002346| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00941|IPR002346| RP:SCP:NREP 2 RP:SCP:REP 4->112|1rm6B2|5e-18|30.2|106/216|d.145.1.3| RP:SCP:REP 177->282|1fiqB1|4e-19|12.3|106/114|d.87.2.1| HM:SCP:REP 3->175|1rm6B2|3.5e-39|35.5|169/0|d.145.1.3|1/1|FAD-binding domain| HM:SCP:REP 176->286|1n62C1|7.4e-25|38.5|109/109|d.87.2.1|1/1|CO dehydrogenase flavoprotein C-terminal domain-like| OP:NHOMO 267 OP:NHOMOORG 188 OP:PATTERN 112-1-2222223322--111----------------------------------------1------ --111----------------1--21-11-112333--211--2----------11------4--33122------------3----------------------1------------------------------11111----5-1------------------------------------2----------------------------------1--------------------------------------------------------------------------------------------------------22--1112122111-----------1----1----221-212---------------------123----2-3-----------1-1111-111-2--1----12211231----2------1-311111111--11--1------------------------------------111--1------------11--------43351--22----11-1-----------------------1--1-1-1-----------1111---1-------2---------------------------1-----1-----------1---------------1------------1--1111111111-111111111111111111--------------------------1--1111-----------------------------1-1---------------111-1-------------------------------------------------------------------------------------------------------------12-1-------- -----------------------------------------------------------------------------------------------------------------------------------------------------------1--1----2----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 283 STR:RPRED 98.6 SQ:SECSTR ###EEEEcccHHHHHHHHHHHcTTcEEccccTTHHHHHHHccccccEEEEccccGGGccEEEcccEEEEETTccHHHHHHcTTTTHHHHHHHHHHTTcccHHHHTTccHHHHHHcccTTcccHHHHHHHTcccEEEcTTccccccccTTccccTTcccccTTcEEEEEEEEcccTTEEEEEEEEccccccccEEEEEEEEccTTcccccEEEEEEETcccccEEcTHHHHHHTTccccHHHHHHHHHHHHHHTcccTTcTTccHHHHHHHHHHHHHHHHHHHHHHc# DISOP:02AL 287-288| PSIPRED ccccEEccccHHHHHHHHHHcccccEEEEcccHHHHHHHcccccccEEEEccccccccEEEEEccEEEEEccccHHHHHccHHHHHHHHHHHHHHHHHccHHHcccccccHHHcccccHHHHHHHHHHcccEEEEEEcccEEEEEHHHHccccccccccccccEEEEEEEEEcccccEEEEEEEccccccccEEEEEEEEEEEEccEEEEEEEEEEcccccEEEHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHccc //