[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50036.1
DDBJ      :             transcriptional regulator, AraC family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  314/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.24.16a.4.1b.82.1
:240 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   143->235 2k9sA PDBj 3e-08 27.2 %
:RPS:PDB   21->80 2d40A PDBj 2e-07 8.3 %
:RPS:PDB   142->240 1bl0A PDBj 4e-19 21.2 %
:RPS:SCOP  21->151 1sfnA  b.82.1.11 * 3e-09 12.9 %
:RPS:SCOP  142->238 1v4aA1  a.24.16.4 * 1e-16 10.3 %
:HMM:SCOP  21->109 1juhA_ b.82.1.5 * 2.6e-06 22.5 %
:HMM:SCOP  142->187 1d5yA1 a.4.1.8 * 3.6e-07 37.2 %
:HMM:SCOP  188->239 1d5yA2 a.4.1.8 * 7.2e-12 44.2 %
:RPS:PFM   197->235 PF00165 * HTH_AraC 1e-06 43.6 %
:HMM:PFM   146->186 PF00165 * HTH_AraC 1.5e-08 24.4 41/42  
:HMM:PFM   199->236 PF00165 * HTH_AraC 1.1e-10 40.5 37/42  
:HMM:PFM   19->82 PF02311 * AraC_binding 3e-08 28.1 64/136  
:BLT:SWISS 1->235 YOBQ_BACSU 7e-44 38.1 %
:PROS 189->231|PS00041|HTH_ARAC_FAMILY_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50036.1 GT:GENE ABO50036.1 GT:PRODUCT transcriptional regulator, AraC family GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1635258..1635980) GB:FROM 1635258 GB:TO 1635980 GB:DIRECTION - GB:PRODUCT transcriptional regulator, AraC family GB:NOTE PFAM: helix-turn-helix- domain containing protein, AraC type KEGG: bsu:BG13508 similar to transcriptional regulator (AraC/XylS family) GB:PROTEIN_ID ABO50036.1 GB:DB_XREF GI:134052065 InterPro:IPR000005 LENGTH 240 SQ:AASEQ MDELRNILCERRIYTNSCLSHAHSFGQLLLPLQGTLFIETNLHRVRLDNKHLFFLPPGDNHTFYSKDKNEFLVLDIPASLLPEQNYKNMDGGVYLPLDQRWESLRFLFLSETGAHSKPNPSLHDLFRYASRLLYNFDQPVSIQYVQNHYQEKISLEYLAALEHYNPSYYCQWFQKKTGLSPLAFIQKLRLEKAKYLLINTDFSLLRIAQEVGYEQQSSLARLFRQKEGMSASDYRKAFQR GT:EXON 1|1-240:0| BL:SWS:NREP 1 BL:SWS:REP 1->235|YOBQ_BACSU|7e-44|38.1|231/241| PROS 189->231|PS00041|HTH_ARAC_FAMILY_1|PDOC00040| BL:PDB:NREP 1 BL:PDB:REP 143->235|2k9sA|3e-08|27.2|92/107| RP:PDB:NREP 2 RP:PDB:REP 21->80|2d40A|2e-07|8.3|60/283| RP:PDB:REP 142->240|1bl0A|4e-19|21.2|99/116| RP:PFM:NREP 1 RP:PFM:REP 197->235|PF00165|1e-06|43.6|39/40|HTH_AraC| HM:PFM:NREP 3 HM:PFM:REP 146->186|PF00165|1.5e-08|24.4|41/42|HTH_AraC| HM:PFM:REP 199->236|PF00165|1.1e-10|40.5|37/42|HTH_AraC| HM:PFM:REP 19->82|PF02311|3e-08|28.1|64/136|AraC_binding| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00165|IPR000005| GO:PFM GO:0005622|"GO:intracellular"|PF00165|IPR000005| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00165|IPR000005| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00165|IPR000005| RP:SCP:NREP 2 RP:SCP:REP 21->151|1sfnA|3e-09|12.9|124/245|b.82.1.11| RP:SCP:REP 142->238|1v4aA1|1e-16|10.3|97/151|a.24.16.4| HM:SCP:REP 21->109|1juhA_|2.6e-06|22.5|89/0|b.82.1.5|1/1|RmlC-like cupins| HM:SCP:REP 142->187|1d5yA1|3.6e-07|37.2|43/54|a.4.1.8|1/2|Homeodomain-like| HM:SCP:REP 188->239|1d5yA2|7.2e-12|44.2|52/0|a.4.1.8|2/2|Homeodomain-like| OP:NHOMO 764 OP:NHOMOORG 316 OP:PATTERN -------------------------------------------------------------------- ----11-------------------------------1-------1--------------1-1-1--112-1----------------3324-1------1----424-2------------------------1---------1-511---------------1---11------------------11--25334332251444233CE6534444254B311222222C*------------------2-3-1----1---11-----131-11231212---111------------------------111---11119731D434444354592332222D-51--24--4312-1---22-1D--1--2---------223-----1--------------1---1-----21--3221---11-131-----2-1-11--1---------------1-------------------------------1---------11---1--------1111112---11---111--------1---1---------------1--2--2--1--1--1--1-11--1-2----1-------11-----------------1-----233-111131-2-----------2111--1---------------2---1111111112--1111121111112111111231--1--2-112222221121121211------1--------------------11-1-1723---11--1111----111-1-1-212-33333344622255222-----------11211111-2233-----------------------------------------------------------------------2- -------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------7------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 183 STR:RPRED 76.2 SQ:SECSTR #################EEEcEEcccEEEEEEEEEEEEEETTEEEEEETTcEEEEcTTccEEEEEEEEEEEEEEEcHHHHccGcccTTcEEEcTccccGGG########################################HHHHHTTTTcccccHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHTTcccHHHHHHHHHHHHcccHHHHHTcccc DISOP:02AL 1-2,118-119,121-125,237-241| PSIPRED cccccccEEcccccccccccEEcccEEEEEEEEEEEEEEEccEEEEEccccEEEEccccEEEEEEccccEEEEEEEcHHHccHHHHHHHccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHcc //