[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50039.1
DDBJ      :             CBS domain containing protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.37.1
:163 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   2->156 2d4zA PDBj 1e-10 9.9 %
:RPS:SCOP  5->155 2j9lA1  d.37.1.1 * 3e-11 12.5 %
:HMM:SCOP  2->73 1nf7A3 d.37.1.1 * 2.3e-08 40.3 %
:HMM:SCOP  93->163 1yavA2 d.37.1.1 * 7.3e-08 29.4 %
:HMM:PFM   7->73 PF00571 * CBS 3.6e-12 41.8 55/57  
:HMM:PFM   105->158 PF00571 * CBS 7.6e-07 24.5 53/57  
:BLT:SWISS 7->130 YUGS_BACSU 2e-04 33.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50039.1 GT:GENE ABO50039.1 GT:PRODUCT CBS domain containing protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1637855..1638346) GB:FROM 1637855 GB:TO 1638346 GB:DIRECTION - GB:PRODUCT CBS domain containing protein GB:NOTE PFAM: CBS domain containing protein GB:PROTEIN_ID ABO50039.1 GB:DB_XREF GI:134052068 InterPro:IPR000644 LENGTH 163 SQ:AASEQ MLQSLTARDVMIPLSDYATVSADDSIRHAIYTLRISIYRDKSGAFHGHRALIVLDNKGNVSGILTLLDLLKAVGLKDHYNDPWVKSASWSWFFINRIHESEGIKVKDIMRPIFLGTVDTQQPIQEVIRKMLLQEENLIPVLENHVPIGVIRTIDLFWLLGNLL GT:EXON 1|1-163:0| BL:SWS:NREP 1 BL:SWS:REP 7->130|YUGS_BACSU|2e-04|33.7|89/429| RP:PDB:NREP 1 RP:PDB:REP 2->156|2d4zA|1e-10|9.9|142/169| HM:PFM:NREP 2 HM:PFM:REP 7->73|PF00571|3.6e-12|41.8|55/57|CBS| HM:PFM:REP 105->158|PF00571|7.6e-07|24.5|53/57|CBS| RP:SCP:NREP 1 RP:SCP:REP 5->155|2j9lA1|3e-11|12.5|136/162|d.37.1.1| HM:SCP:REP 2->73|1nf7A3|2.3e-08|40.3|62/0|d.37.1.1|1/2|CBS-domain| HM:SCP:REP 93->163|1yavA2|7.3e-08|29.4|68/0|d.37.1.1|2/2|CBS-domain| OP:NHOMO 15 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------651-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 154 STR:RPRED 94.5 SQ:SECSTR #cccccTTcccccccccccEETTccHHHHHHHHHHTcE#######ccccEEEEEccTccEEEEEEHHHHHHHHHHHHHTTccccccccccHHHHHHHTTccccTTcccEEccccEcccTTccHHHHHHHHHHHTccEEEEEETTEEEEEEEHHHHHHHHHHc# DISOP:02AL 1-5| PSIPRED ccccccccEEEEEEcccEEEcccccEEEEEEEEEEEEEEccccccccEEEEEEEEccccHHHHHHHHHHHHHccccccccccccccccEEEEEEEEEcccccccHHHHHHcEEEEccccHHHHHHHHHHHHHcccccccHHHccccEEHHHHHHHHHHHHHHc //