[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50045.1
DDBJ      :             transcriptional regulator, GntR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  147/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:120 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->117 3by6E PDBj 2e-11 35.2 %
:RPS:PDB   25->120 3by6D PDBj 5e-11 33.3 %
:RPS:SCOP  25->75 1e2xA1  a.4.5.6 * 4e-10 25.5 %
:HMM:SCOP  1->102 1v4rA1 a.4.5.6 * 2.8e-18 34.0 %
:RPS:PFM   25->73 PF00392 * GntR 2e-05 46.9 %
:HMM:PFM   11->73 PF00392 * GntR 4e-17 42.9 63/64  
:BLT:SWISS 26->118 YHCF_BACSU 5e-24 52.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50045.1 GT:GENE ABO50045.1 GT:PRODUCT transcriptional regulator, GntR family GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1644599..1644961) GB:FROM 1644599 GB:TO 1644961 GB:DIRECTION - GB:PRODUCT transcriptional regulator, GntR family GB:NOTE PFAM: regulatory protein GntR, HTH KEGG: bha:BH0383 transcriptional regulator (GntR family) GB:PROTEIN_ID ABO50045.1 GB:DB_XREF GI:134052074 InterPro:IPR000524 LENGTH 120 SQ:AASEQ MTNFNNTQPIYLQIIQRLCRQIIRGELNAGDKLPSVRELAIQLGVNPNTTQRVYAEMERIEVAETRRGLGTFITENESRLIQLREELMSEQIISFINDMKEMGFTAAEIVEGVRKVLEKE GT:EXON 1|1-120:0| BL:SWS:NREP 1 BL:SWS:REP 26->118|YHCF_BACSU|5e-24|52.7|93/121| SEG 10->24|iylqiiqrlcrqiir| BL:PDB:NREP 1 BL:PDB:REP 27->117|3by6E|2e-11|35.2|91/124| RP:PDB:NREP 1 RP:PDB:REP 25->120|3by6D|5e-11|33.3|96/121| RP:PFM:NREP 1 RP:PFM:REP 25->73|PF00392|2e-05|46.9|49/64|GntR| HM:PFM:NREP 1 HM:PFM:REP 11->73|PF00392|4e-17|42.9|63/64|GntR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00392|IPR000524| GO:PFM GO:0005622|"GO:intracellular"|PF00392|IPR000524| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00392|IPR000524| RP:SCP:NREP 1 RP:SCP:REP 25->75|1e2xA1|4e-10|25.5|51/73|a.4.5.6| HM:SCP:REP 1->102|1v4rA1|2.8e-18|34.0|100/0|a.4.5.6|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 205 OP:NHOMOORG 147 OP:PATTERN -------------------------------------------------------------------- --1-----------------------------------------------------------------11----------31------------11--------------------------------------------------------------------------------------------11-1-22222222222222222222122221--1111333323-21--------------1-----112112-11111--11--1111---1111111-11111111111111111111111111-11111111112-1222222222221-11211122-21-21--1111-2---1---1---1-1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------1----------------------------1----------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 96 STR:RPRED 80.0 SQ:SECSTR ########################TcccTTcEEccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEETTTEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHTcc DISOP:02AL 1-6,8-8,79-88,120-121| PSIPRED cccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEccccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcc //