[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50049.1
DDBJ      :             GreA/GreB family elongation factor
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  280/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.26.1
:137 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   43->135 3bmbA PDBj 1e-20 47.3 %
:RPS:PDB   43->137 3bmbA PDBj 1e-29 46.3 %
:RPS:SCOP  54->125 2etnA2  d.26.1.2 * 4e-19 43.1 %
:HMM:SCOP  50->128 1grjA2 d.26.1.2 * 1.5e-22 45.6 %
:RPS:PFM   53->116 PF01272 * GreA_GreB 1e-07 45.3 %
:HMM:PFM   52->127 PF01272 * GreA_GreB 6.3e-26 44.7 76/77  
:HMM:PFM   11->40 PF03776 * MinE 0.00034 26.7 30/70  
:BLT:SWISS 43->135 RNK_SHIFL 3e-20 47.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50049.1 GT:GENE ABO50049.1 GT:PRODUCT GreA/GreB family elongation factor GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1648287..1648700) GB:FROM 1648287 GB:TO 1648700 GB:DIRECTION - GB:PRODUCT GreA/GreB family elongation factor GB:NOTE PFAM: transcription elongation factor GreA/GreB domain protein KEGG: dsy:DSY4983 hypothetical protein GB:PROTEIN_ID ABO50049.1 GB:DB_XREF GI:134052078 InterPro:IPR001437 LENGTH 137 SQ:AASEQ MERKIYITSADKERLEKLIIKEKEFNPASKEYLKSLEEELKLAQVVPSKEIPQDVITMNSKVLLKDLDADEELTYSLVYPADADLLEDKISILAPVGTAILGYRVGDVVNWKVPDGVVQLKVENILYQPEATGDYDL GT:EXON 1|1-137:0| BL:SWS:NREP 1 BL:SWS:REP 43->135|RNK_SHIFL|3e-20|47.3|93/136| SEG 12->24|kerlekliikeke| SEG 29->42|skeylksleeelkl| BL:PDB:NREP 1 BL:PDB:REP 43->135|3bmbA|1e-20|47.3|93/135| RP:PDB:NREP 1 RP:PDB:REP 43->137|3bmbA|1e-29|46.3|95/135| RP:PFM:NREP 1 RP:PFM:REP 53->116|PF01272|1e-07|45.3|64/78|GreA_GreB| HM:PFM:NREP 2 HM:PFM:REP 52->127|PF01272|6.3e-26|44.7|76/77|GreA_GreB| HM:PFM:REP 11->40|PF03776|0.00034|26.7|30/70|MinE| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF01272|IPR001437| GO:PFM GO:0003711|"GO:transcription elongation regulator activity"|PF01272|IPR001437| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01272|IPR001437| RP:SCP:NREP 1 RP:SCP:REP 54->125|2etnA2|4e-19|43.1|72/79|d.26.1.2| HM:SCP:REP 50->128|1grjA2|1.5e-22|45.6|79/79|d.26.1.2|1/1|FKBP-like| OP:NHOMO 299 OP:NHOMOORG 281 OP:PATTERN -------------------------------------------------------------------- --1-------------------------------------------------------------------------------------111--111---2-2-21212-2------------------------1--------------------------------------------------------1---------------------------------------12------------------------------------------------------------------------------------------11111111111111111111111--1-111-1111221-1--1111-----1---------------1-1---1-111-1-11111---------1--------------------2------------------------1-------------------------------11---11--111111-1111111-1111-11111111--111-111111--1----11-11--------11111-1---1-11-------2-2113-12--2-1111---------1-----------------11--1---1--11111-1-1111-1--1-----1111------1111-1-1111111111-1121111111111111111-1-111111111111111111111111-1111--111111111111---1----------1--1--------------------------111111211111111111--------------11111-1-111111111111--------11----------------------------------------------1111-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 95 STR:RPRED 69.3 SQ:SECSTR ##########################################cEEEcGGGccTTcccTTcEEEEEETTTccEEEEEEEcGGGcccTTTEEETTcHHHHHHTTccTTcEEEEEETTTEEEEEEEEEEEcTTTTTcccc DISOP:02AL 1-1,131-138| PSIPRED cccHHHHHHHHHHHHHccHHHcccccHHHHHHHHHHHHHHHHcEEEccccccccEEEcccEEEEEEcccccEEEEEEccHHHccccccEEEEccHHHHHHcccccccEEEEEcccccEEEEEEEEEEcccccccccc //