[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50054.1
DDBJ      :             protein of unknown function DUF6, transmembrane
Swiss-Prot:             

Homologs  Archaea  24/68 : Bacteria  367/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:312 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  40->136 1s7bA  f.39.1.1 * 2e-07 9.3 %
:RPS:SCOP  225->291 1s7bA  f.39.1.1 * 7e-05 11.9 %
:HMM:SCOP  38->140 1s7bA_ f.39.1.1 * 2.4e-11 24.8 %
:HMM:SCOP  194->301 1s7bA_ f.39.1.1 * 9.2e-14 27.6 %
:RPS:PFM   14->136 PF00892 * EamA 3e-07 27.6 %
:RPS:PFM   161->289 PF00892 * EamA 6e-04 24.8 %
:HMM:PFM   14->136 PF00892 * EamA 7.8e-23 26.8 123/126  
:HMM:PFM   161->292 PF00892 * EamA 6.1e-24 29.0 124/126  
:BLT:SWISS 1->292 Y510_ARCFU 1e-36 35.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50054.1 GT:GENE ABO50054.1 GT:PRODUCT protein of unknown function DUF6, transmembrane GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1652842..1653780) GB:FROM 1652842 GB:TO 1653780 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF6, transmembrane GB:NOTE PFAM: protein of unknown function DUF6, transmembrane KEGG: afu:AF0510 hypothetical protein GB:PROTEIN_ID ABO50054.1 GB:DB_XREF GI:134052083 InterPro:IPR000620 LENGTH 312 SQ:AASEQ MGRYIHLLLLTVSFFWGTSFAAAKIGLQELHPLNLVILRFTIASVIFYVLLQIRKERAIEVKDIPTFIILGFMGITSYFYIQFTGLQYTNTIHSALIIATSPIMVAIIGAALKIEKISRAMSCGIALSFIGVSLVISEGNWAGIFQSTTIKGDLMLLSNAIVWAGFTLYGKKILLKYSPFVAMAYIHIFGTLLLLPLLAVPDLLGTHSLMKQLAELSWPTVSAALYLALFCSVYAYFVWYAGVEKIGAIRTSVFAYFNPLFATLTGVLLLNEKISFITIFGGCMVMAGVYITNEFKPKTAARDNKKGLNISD GT:EXON 1|1-312:0| BL:SWS:NREP 1 BL:SWS:REP 1->292|Y510_ARCFU|1e-36|35.0|277/289| TM:NTM 9 TM:REGION 4->26| TM:REGION 31->53| TM:REGION 58->79| TM:REGION 91->113| TM:REGION 118->139| TM:REGION 179->201| TM:REGION 220->242| TM:REGION 246->268| TM:REGION 272->294| SEG 192->204|llllpllavpdll| RP:PFM:NREP 2 RP:PFM:REP 14->136|PF00892|3e-07|27.6|123/125|EamA| RP:PFM:REP 161->289|PF00892|6e-04|24.8|121/125|EamA| HM:PFM:NREP 2 HM:PFM:REP 14->136|PF00892|7.8e-23|26.8|123/126|EamA| HM:PFM:REP 161->292|PF00892|6.1e-24|29.0|124/126|EamA| GO:PFM:NREP 2 GO:PFM GO:0016020|"GO:membrane"|PF00892|IPR000620| GO:PFM GO:0016020|"GO:membrane"|PF00892|IPR000620| RP:SCP:NREP 2 RP:SCP:REP 40->136|1s7bA|2e-07|9.3|97/106|f.39.1.1| RP:SCP:REP 225->291|1s7bA|7e-05|11.9|67/106|f.39.1.1| HM:SCP:REP 38->140|1s7bA_|2.4e-11|24.8|101/106|f.39.1.1|1/2|Multidrug resistance efflux transporter EmrE| HM:SCP:REP 194->301|1s7bA_|9.2e-14|27.6|105/106|f.39.1.1|2/2|Multidrug resistance efflux transporter EmrE| OP:NHOMO 702 OP:NHOMOORG 393 OP:PATTERN ---11-1-----------1---121---------1---32332--1----1-1--22-111-111--- 131--------------------------------------------1---------------------------------11-----3324-2--------112-11--------------------------1-111--111-21------------------------------------111--11112-5565678A5746788-111158752134--111111182-11---1-1-1111-----------------------------------------------------------------------------3-2111111111111-33-11123---1--2-3323--1222111--311-1--------11-4321-121211----------2---------11--122-1122321111--------1121-11111111---1---2-----------------------------1-11-1-111-455433-----44112111-141-2223-1111--111312123112-1--32----------122-26-5224326553-2-21----111-11--21----------------------------1----1-11-1111---2111-1--1------1-1------111--111111111111-11111111-1111111111111-332-1-11--111-1111111--1111-------1----111---111-11------2-3----12-1------23332332--11-1211-1131121--2-1221211112-1211-----21-11----------------------11------------------------------------22-3121112--1 -----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,295-306,308-313| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccccc //