[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50058.1
DDBJ      :             extracellular solute-binding protein, family 1
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  401/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:355 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   42->355 2pt2A PDBj 8e-96 51.9 %
:RPS:PDB   42->355 1d9yA PDBj 1e-40 26.5 %
:RPS:SCOP  42->354 1q35A  c.94.1.1 * 1e-99 44.2 %
:HMM:SCOP  37->352 1xvxA_ c.94.1.1 * 8.3e-87 35.7 %
:HMM:PFM   50->301 PF01547 * SBP_bac_1 9.7e-21 23.9 243/314  
:HMM:PFM   1->54 PF09716 * ETRAMP 0.00078 29.4 34/84  
:BLT:SWISS 10->355 FUTA1_SYNY3 1e-96 49.1 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50058.1 GT:GENE ABO50058.1 GT:PRODUCT extracellular solute-binding protein, family 1 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1660060..1661127 GB:FROM 1660060 GB:TO 1661127 GB:DIRECTION + GB:PRODUCT extracellular solute-binding protein, family 1 GB:NOTE PFAM: extracellular solute-binding protein, family 1 KEGG: ter:Tery_3377 extracellular solute-binding protein, family 1 GB:PROTEIN_ID ABO50058.1 GB:DB_XREF GI:134052087 InterPro:IPR000437 InterPro:IPR006059 InterPro:IPR011587 LENGTH 355 SQ:AASEQ MKNIKAVMVFLVITAMLVLSGCSASNNNTASKETDNKENGVINLYTDRHYDTDQALFDLFTKETGIKVNVVKAESDELIERLAREGKDTKADLLITADAGRLYRAKEKELLQTTSSETLFKNVPENLRDKDNQWFGLTKRARVIVYAKDRVDPAQLSTYEDLTDAKWKGKVLVRSANNIYNQSLLASFIALNGEDQAKAWAKDLVANMAREPKGNDRDQAKAVVAGEGDVAIMNTYYVGKMLHSSDPEEVKVANKVAVFFPNQNTTGTHINVSGVGLTKYAKNKDNAIKLMEFLSSEKAQKQFAEANFEYPVNPNVEPSELLKSWGDFKAQDINLSLLGENNQKAVRIFNEVGWK GT:EXON 1|1-355:0| BL:SWS:NREP 1 BL:SWS:REP 10->355|FUTA1_SYNY3|1e-96|49.1|344/360| TM:NTM 1 TM:REGION 4->25| BL:PDB:NREP 1 BL:PDB:REP 42->355|2pt2A|8e-96|51.9|314/316| RP:PDB:NREP 1 RP:PDB:REP 42->355|1d9yA|1e-40|26.5|306/309| HM:PFM:NREP 2 HM:PFM:REP 50->301|PF01547|9.7e-21|23.9|243/314|SBP_bac_1| HM:PFM:REP 1->54|PF09716|0.00078|29.4|34/84|ETRAMP| RP:SCP:NREP 1 RP:SCP:REP 42->354|1q35A|1e-99|44.2|308/317|c.94.1.1| HM:SCP:REP 37->352|1xvxA_|8.3e-87|35.7|308/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 526 OP:NHOMOORG 414 OP:PATTERN ------------------------1--11--1-----11-1-------------111--11------- ----2----------------2---1------1112-143--11--------111-1---1-1---------------11--1-------------------------1---------------------------11111---11111122111221111122211-1-11111111111111--11------33333333233333321--1-333-11-1-1------3----------------1----------------------1-------1111-11---1----1--1--1----1------------------1---1111111212-----111-111-2-------1-1-1---------------------1------11111111111111111-11111111111-12211111111111-111221111311---------------11111111111---------------11111-----12111222222-111122211111113121-1------112111111111111---1111111111-111211--1-1---1-----------1-----1---1--1-111111-------------1--111-1-1111112111-1111111111111----111------1-1111--11--------1---------1--------11244---1-111111111111111---------111111111111---1----------1112---222111111222-------1121122212332-22221111----------11111111111121--------------11-6--------------1---------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 353 STR:RPRED 99.4 SQ:SECSTR #EEcEEEcccccccccccEEEEEccTTccTTcEE#cTTccEEEEEEcccHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHGGGccccEEEEccHHHHHHHHHTTccccccTTHHHHTccTTccccTTccEEEEEEEEEEEEETTTccGGGcccGGGGccGGGTTTEEEcTTcHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcEEcccHHHHHHHHHHHTTcccEEEEETHHHHHHHHHHcGGGccEETEEEEEcccTTcGGGcEEEEEEEEcTTcccHHHHHHHHHHHHcHHHHHHHHHHcccEEccTTcccccccccHHHHTccccccccHHHHHHHHHHHHHHHTcc DISOP:02AL 1-3,26-36| PSIPRED ccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEcccHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHccccccccEEEEccHHHHHHHHHccccccccHHHHHHHccHHHHcccccEEEEEEEEEEEEEEHHHccccccccHHHHHcHHHcccEEEcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccEEEccccHHHHHHHHcccccEEEEccHHHHHHHccccHHHHHccccccEEEccccccccEEEEEEEEEEcccccHHHHHHHHHHHccHHHHHHHHHHcccccccccccccHHHccccccccccccHHHHHHHHHHHHHHHHHcccc //