[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50089.1
DDBJ      :             Cupin 2, conserved barrel domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.82.1
:105 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   17->100 1o4tA PDBj 3e-04 27.2 %
:RPS:PDB   23->104 2arcA PDBj 1e-14 12.7 %
:RPS:SCOP  23->104 2f4pA1  b.82.1.9 * 8e-13 24.1 %
:HMM:SCOP  23->104 2bnmA2 b.82.1.10 * 5.7e-18 30.5 %
:RPS:PFM   33->95 PF07883 * Cupin_2 6e-07 33.3 %
:HMM:PFM   32->102 PF07883 * Cupin_2 1.8e-14 27.9 68/71  
:HMM:PFM   12->42 PF07847 * DUF1637 0.00021 25.8 31/196  
:BLT:SWISS 22->87 RFBM_SALTY 4e-04 29.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50089.1 GT:GENE ABO50089.1 GT:PRODUCT Cupin 2, conserved barrel domain protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1700076..1700393 GB:FROM 1700076 GB:TO 1700393 GB:DIRECTION + GB:PRODUCT Cupin 2, conserved barrel domain protein GB:NOTE PFAM: Cupin 2, conserved barrel domain protein KEGG: gka:GK2892 hypothetical protein GB:PROTEIN_ID ABO50089.1 GB:DB_XREF GI:134052118 InterPro:IPR013096 LENGTH 105 SQ:AASEQ MQVIAITDIVADKNPAIVMKTIFSDKNITMGTVVIPPGARIPKQGIGVHEGDEYSLILKGSIKTMSGGKEYQVQGGQATFIPAGEEHWCCNDDTEECEIVWFLTK GT:EXON 1|1-105:0| BL:SWS:NREP 1 BL:SWS:REP 22->87|RFBM_SALTY|4e-04|29.7|64/479| BL:PDB:NREP 1 BL:PDB:REP 17->100|1o4tA|3e-04|27.2|81/115| RP:PDB:NREP 1 RP:PDB:REP 23->104|2arcA|1e-14|12.7|79/161| RP:PFM:NREP 1 RP:PFM:REP 33->95|PF07883|6e-07|33.3|60/70|Cupin_2| HM:PFM:NREP 2 HM:PFM:REP 32->102|PF07883|1.8e-14|27.9|68/71|Cupin_2| HM:PFM:REP 12->42|PF07847|0.00021|25.8|31/196|DUF1637| RP:SCP:NREP 1 RP:SCP:REP 23->104|2f4pA1|8e-13|24.1|79/134|b.82.1.9| HM:SCP:REP 23->104|2bnmA2|5.7e-18|30.5|82/0|b.82.1.10|1/1|RmlC-like cupins| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 96 STR:RPRED 91.4 SQ:SECSTR ########cccGGTcccccTTccEEEEEEEETTcTTcccEEETTcccccccEEEEEEEEEcEEEEETTEEEEEcTTcEEEEcTTccEEEEEcTTccEEEEEEEE# PSIPRED cEEEEEEEEEEccccEEEEEEEEccccEEEEEEEEcccccccccccccccccEEEEEEEEEEEEEEccEEEEEccccEEEEcccccEEEEEcccccEEEEEEEcc //