[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50102.1
DDBJ      :             ABC transporter related
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:247 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   22->216 2it1B PDBj 6e-35 39.5 %
:RPS:PDB   1->242 3cmvG PDBj 3e-37 10.0 %
:RPS:SCOP  4->241 1b0uA  c.37.1.12 * 4e-40 27.5 %
:HMM:SCOP  4->221 1g6hA_ c.37.1.12 * 1.2e-52 38.5 %
:RPS:PFM   47->162 PF00005 * ABC_tran 7e-20 45.1 %
:HMM:PFM   47->163 PF00005 * ABC_tran 5.7e-23 35.4 113/118  
:HMM:PFM   12->65 PF03193 * DUF258 2.9e-07 26.4 53/161  
:BLT:SWISS 4->247 Y412_METJA 3e-54 45.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50102.1 GT:GENE ABO50102.1 GT:PRODUCT ABC transporter related GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1712788..1713531) GB:FROM 1712788 GB:TO 1713531 GB:DIRECTION - GB:PRODUCT ABC transporter related GB:NOTE PFAM: ABC transporter related SMART: AAA ATPase KEGG: mja:MJ0412 putative taurine transport system ATP-binding protein GB:PROTEIN_ID ABO50102.1 GB:DB_XREF GI:134052131 InterPro:IPR003439 InterPro:IPR003593 LENGTH 247 SQ:AASEQ MAGVNIKGLCKTYTIHSQEVQALSNINLTIQDGSFVTLVGKSGSGKTTLLRLLCGLEQATQGEISFLSPKKERAVGKERISIVFQEPRLMPWLTVEQNMAFALFKEKDPLRVSRTVSHFLDMLGLKKFKDAYPAQISGGMAQRTSLGRTLCYDPDIILMDEPLGALDAFTRKNLQAELVEIFLLQKKTIIFVTHDVDEAVFLGQRVVIFEGGKIVEDVPVSLNYPRNPLSPDFFQIRERILGVVLGE GT:EXON 1|1-247:0| BL:SWS:NREP 1 BL:SWS:REP 4->247|Y412_METJA|3e-54|45.0|242/267| BL:PDB:NREP 1 BL:PDB:REP 22->216|2it1B|6e-35|39.5|195/361| RP:PDB:NREP 1 RP:PDB:REP 1->242|3cmvG|3e-37|10.0|240/1167| RP:PFM:NREP 1 RP:PFM:REP 47->162|PF00005|7e-20|45.1|113/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 47->163|PF00005|5.7e-23|35.4|113/118|ABC_tran| HM:PFM:REP 12->65|PF03193|2.9e-07|26.4|53/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 4->241|1b0uA|4e-40|27.5|233/258|c.37.1.12| HM:SCP:REP 4->221|1g6hA_|1.2e-52|38.5|213/254|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 48579 OP:NHOMOORG 1173 OP:PATTERN TTKASKHLXWYVWTbNlIOOLNJVwMPmjXdUHBDEDDHHHFCSbOUgLP**h9VgTVXKVMKFW17B QanK*bYWhhhQXKVTTLL-LbBBV*LLLLLMqkjmn***U*V*n*ucnfZL*wqMSaCDrtud*oz***dbUTTuaXXN*blDBEBCOONK4LCGJ--FFRHKJbLWMQ8999999BCDCCCCJTPJSTNMUWZRlqqz*IIG*ZnkqvihnbgQRNGPJMKZeZf***ZMPILJKJLJMHLjTbMLtkATet************************fnv**gpusrppq**YopqormmnoooonncjecdzjXb**dPcYlwvOP**YVTZmlghjsqusqjwpqpsvstooqwostcabbaccdddcbbyhjbackjlin*w*********i*lx***ckkg*tgvr*emSL**uoacjlTbhdtlQeXYNgWTTKJIKJKZU***YUo****************-qs*jh*n***PC**************IJJ**********SRSSSSSSyZdJQfX*66566555546777BC77976877886A6MDCFDE************************o********9N**r*kwmt******YnjOUMQnaJIHHGGHPNOYsidz*RdVvkWjufdpJdYaTUZiTWWYWYm*a*MKOSHNNOQMECCFFFEEEFHUFHJPOsovNrReKWNzNTYZVLVcUTUUSWaXXXb5-EJTOO231111****Z**********y*-**y**********wxzxwv*****iihrqnqpsrssrnqsqqn*uppuutxT3************33MJFHEFFOPOOQL*o*bcbZdZMQTNNUSWgQSURSISHQTqZxvuwx***t****h***GGFEEGFEGLhpo*sstts*****PONMMNMKMLDCBC76KWTTLMKKBA8A89A9*DaDBACD-CEFDEHFRQMCGMDIE99BVqyXWn*nokDbN 1455kcG-aJ8BOWPF9EB9IKGIEJGIIBD8CJGDAICFDDFBCAHDFHGINLBED8CCBA99766727846898726689897745-C869D5A776A95EKGC4HVmiSbUjXjLIFDGYLuq9*C**s4xWnLKFBgCMvb9KADCcAA*FaUQtIj*NqPbAyXd*faaMFFCD*9ABHGobf*B*gHEmfhdL ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,247-248| PSIPRED ccEEEEEEEEEEEccccccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEccccccHHcEEEEEccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHccHHHcccHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHHHHccEEEEEEccHHHHHHHccEEEEEEccEEEEEcccccccccccccHHHHHHHHHHHHHHccc //