[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50103.1
DDBJ      :             binding-protein-dependent transport systems inner membrane component
Swiss-Prot:             

Homologs  Archaea  24/68 : Bacteria  538/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:254 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   146->179 3dhwA PDBj 1e-05 23.5 %
:RPS:SCOP  36->247 2r6gG1  f.58.1.1 * 2e-13 12.3 %
:RPS:PFM   144->205 PF00528 * BPD_transp_1 6e-04 30.6 %
:HMM:PFM   73->241 PF00528 * BPD_transp_1 7.4e-23 21.9 169/185  
:BLT:SWISS 3->244 SSUC_BACSU 4e-37 32.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50103.1 GT:GENE ABO50103.1 GT:PRODUCT binding-protein-dependent transport systems inner membrane component GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1713518..1714282) GB:FROM 1713518 GB:TO 1714282 GB:DIRECTION - GB:PRODUCT binding-protein-dependent transport systems inner membrane component GB:NOTE PFAM: binding-protein-dependent transport systems inner membrane component KEGG: dsy:DSY2483 hypothetical protein GB:PROTEIN_ID ABO50103.1 GB:DB_XREF GI:134052132 InterPro:IPR000515 LENGTH 254 SQ:AASEQ MHYLKGFVIPFVILILWLIGSATESINQYIIPPPTKVLQTALDLTASGILLKHITISLYRVFAGFLLTVLFAFPLAILVGINQRLAPYIDPVLDFLGHIPPISCIPILILWFGIGETSKLAVIILATFFPVFLNTLNGILGCNKQLLEVGDVFGFTARDKFLRIVIPAALPSIIVGFRLGLGYSWRSLIGAELIAASSGIGYMIIDAEQLSRPDIIIVGILTIGLFGYIIDYCFFKLTNHLIPWAGKRVSYGRS GT:EXON 1|1-254:0| BL:SWS:NREP 1 BL:SWS:REP 3->244|SSUC_BACSU|4e-37|32.2|242/276| TM:NTM 6 TM:REGION 3->25| TM:REGION 52->74| TM:REGION 111->133| TM:REGION 160->182| TM:REGION 187->209| TM:REGION 214->236| SEG 99->110|ippiscipilil| RP:PDB:NREP 1 RP:PDB:REP 146->179|3dhwA|1e-05|23.5|34/203| RP:PFM:NREP 1 RP:PFM:REP 144->205|PF00528|6e-04|30.6|62/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 73->241|PF00528|7.4e-23|21.9|169/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 36->247|2r6gG1|2e-13|12.3|212/284|f.58.1.1| OP:NHOMO 1874 OP:NHOMOORG 565 OP:PATTERN ----1------------------1--------11-1111122132221112121-------------1 -1-12--1113---433----2---9------23337A85-315311--11-624111--11--4244253-111---1--12----1----------------------1-------11111111---1-----122221---34213222322342-1--13323533-1-----------111--21-1-33333344443434448133214331-32---1111112A111111111111111-1111--1-22---------32--1-11----------1221111-111111--------------11---111-11228111233212124882111214--31---87152-2--61111--1--1222------55HJT-35922C455545454547-CBFA9CBA6B1-MAA9867B9B65JE1--5382634424323333331---24-------------------------------1-11-15GDA53ACCB333443888744443295PA6B7-3774254125653FE26-162411-------21-1231251221-111--2127--2-31-222219151221----------------12-1---2121122-2-2---------------------1-311------6475-342222222222-2222222212222222222464781112212222222222222311221221-244444424444--------------2232-----1-111-1--15554513--1A686577876357454554---------2-11------232111-2-1------------4-------------------------------------------11--11111--2 -------------------------------------------------------------------------------------------------------------------------------------------------------------------3---------------------2--2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 34 STR:RPRED 13.4 SQ:SECSTR #################################################################################################################################################TTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHH########################################################################### DISOP:02AL 1-1,251-255| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc //