[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50108.1
DDBJ      :             protein of unknown function DUF21
Swiss-Prot:             

Homologs  Archaea  18/68 : Bacteria  866/915 : Eukaryota  60/199 : Viruses  0/175   --->[See Alignment]
d.145.1d.37.1
:445 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   218->341 3hf7A PDBj 4e-13 33.6 %
:RPS:PDB   132->346 3bp1B PDBj 4e-33 7.9 %
:RPS:PDB   354->430 3dedB PDBj 6e-08 18.9 %
:RPS:SCOP  196->350 2ooxE1  d.37.1.1 * 1e-22 15.5 %
:RPS:SCOP  354->430 2pliA1  d.145.1.4 * 1e-13 23.4 %
:HMM:SCOP  211->270 1nf7A3 d.37.1.1 * 5.3e-09 35.6 %
:HMM:SCOP  288->347 1zfjA3 d.37.1.1 * 1.2e-08 33.3 %
:RPS:PFM   26->170 PF01595 * DUF21 1e-23 40.6 %
:RPS:PFM   357->430 PF03471 * CorC_HlyC 1e-05 32.4 %
:HMM:PFM   5->201 PF01595 * DUF21 3.6e-54 31.9 182/183  
:HMM:PFM   357->430 PF03471 * CorC_HlyC 5.8e-19 29.7 74/81  
:HMM:PFM   217->270 PF00571 * CBS 6.5e-07 27.5 51/57  
:HMM:PFM   291->339 PF00571 * CBS 4.2e-10 26.5 49/57  
:BLT:SWISS 26->396 YRKA_BACSU 2e-89 50.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50108.1 GT:GENE ABO50108.1 GT:PRODUCT protein of unknown function DUF21 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1717356..1718693 GB:FROM 1717356 GB:TO 1718693 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF21 GB:NOTE PFAM: CBS domain containing protein; protein of unknown function DUF21; transporter-associated region KEGG: gka:GK0564 hemolysin GB:PROTEIN_ID ABO50108.1 GB:DB_XREF GI:134052137 InterPro:IPR000644 InterPro:IPR002550 InterPro:IPR005170 LENGTH 445 SQ:AASEQ MILVNLVIMIILITATAFFVTTEFAMVKVRDSRIEQLIQEGNKRAESVRKVIYNLDGYLSACQLGITLTALGLGWIGEPAVSNVIEPVIHYLGLPVAVTQGLSFIIGFATITFLHVVVGELAPKTLAIQRAEQVTLAVSSTLIWFYKVMYPAIWLLNGSARYIIKLIGLQVVSEHHQIHSEEEIRMILLQSHKGGEITQTELQLARNSLHFADRVAAEIMVPRPDMVCLYTNLSWEENLKIITEEKYARYPVCDGDKDYIIGFVNTKDLCFSGLTDLNMLNLEGFLKQALRKAMVVTELTPIDEILKKMQKNRLQMAIVQDEYGGTAGLLTLEDILEEIVGEIQDEHDEERQLIESLGGNRYSLDARLPIADFNLEFDLDLKAKGVYTLAGWFQEESHRTPEKGQTVRYKNLQFSISEIDKNTIRRIEMTFFRNHDHSNSGFSEF GT:EXON 1|1-445:0| BL:SWS:NREP 1 BL:SWS:REP 26->396|YRKA_BACSU|2e-89|50.0|370/434| TM:NTM 4 TM:REGION 5->27| TM:REGION 57->79| TM:REGION 92->114| TM:REGION 142->164| SEG 1->25|milvnlvimiilitataffvttefa| SEG 173->184|sehhqihseeei| BL:PDB:NREP 1 BL:PDB:REP 218->341|3hf7A|4e-13|33.6|122/127| RP:PDB:NREP 2 RP:PDB:REP 132->346|3bp1B|4e-33|7.9|214/250| RP:PDB:REP 354->430|3dedB|6e-08|18.9|74/83| RP:PFM:NREP 2 RP:PFM:REP 26->170|PF01595|1e-23|40.6|133/184|DUF21| RP:PFM:REP 357->430|PF03471|1e-05|32.4|74/81|CorC_HlyC| HM:PFM:NREP 4 HM:PFM:REP 5->201|PF01595|3.6e-54|31.9|182/183|DUF21| HM:PFM:REP 357->430|PF03471|5.8e-19|29.7|74/81|CorC_HlyC| HM:PFM:REP 217->270|PF00571|6.5e-07|27.5|51/57|CBS| HM:PFM:REP 291->339|PF00571|4.2e-10|26.5|49/57|CBS| RP:SCP:NREP 2 RP:SCP:REP 196->350|2ooxE1|1e-22|15.5|155/179|d.37.1.1| RP:SCP:REP 354->430|2pliA1|1e-13|23.4|77/84|d.145.1.4| HM:SCP:REP 211->270|1nf7A3|5.3e-09|35.6|59/0|d.37.1.1|1/2|CBS-domain| HM:SCP:REP 288->347|1zfjA3|1.2e-08|33.3|60/62|d.37.1.1|2/2|CBS-domain| OP:NHOMO 2437 OP:NHOMOORG 944 OP:PATTERN ------------------------533333411----------12122---11-------------12 2221423555533333333-36--3333333-66665355253553437443756233--444253459942222222112-2222223333-322---223133424-1222222222222222221112221312222211122144233222111111112213233211111111112131311111-344444443444444442-6435445322234333333343222222222222222222231212222222211222221111121111111111111111111111111111111111111111111111-22231112222212123312222-122122-13311-11-------112412333322222233333323333333333333334-223225232332433244444433322323243333222333333332333233422222222222222122222222222222-22222333233333333333333333333233333334124443243343223222533234322222222223332122224322232322222222223333331211111111111121111111-1--122554233223424444434844444553434--3422221-11155344544444444443-3444444444344444444555444445555445444555555544455542-55455445455512332222233332323333333333332233333333344325333333434333323434333323323244434444434444333333333222222253111111222222223221111---1-1-11------1-1--11111111111113 --------211--------------------------------------------------------------------------------------------1---12-1223142---2-2-3312-472-212-21-11121------1-311315---111--------112--17111-141-2-21212---5 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 293 STR:RPRED 65.8 SQ:SECSTR ###################################################################################################################################EEEEEEEEEEEEEEcTTccEEEEEEEEEEETTccEEEcHHHHHHTTTTcccccHHHHHHHHHHHHHHHHTcccEEEEEEGGGGTTcccccccEEccccccccccccccGGGGTTcEEEEEEEEEEEEEEEEEcccEEEHEEEEEEEEEEcHHHHHHHTTccccHHHHHHHHHHHHHHTcccEEEEEEEEcccTTEEEEEEEEcccccccccccTcccGG###EEEcTTccEEEET#ccHHHHHHHHTcccccTTcccHHHHHHHH#cccccTTcEEEETTEEEEEEEET#TEEEEEEEE############### DISOP:02AL 35-45,173-182,431-446| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccEEEHHccEEHHHEEEEcccccHHHHHHHHHHccccEEEEEccccccEEEEEEHHHHHHHHHcccccccHHHHHHHHccccEEEcccccHHHHHHHHHHccccEEEEEEccccEEEEEEHHHHHHHHHccccccccccHHHHEEEcccEEEEEEEccHHHHHHHHcccccccccccHHHHHHHHHccccccccEEEEccEEEEEEEEcccEEEEEEEEEcccccccccccccc //