[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50112.1
DDBJ      :             Stage II sporulation E family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.219.1
:383 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   82->155 3e1iB PDBj 7e-04 19.4 %
:HMM:SCOP  3->220 1txoA_ d.219.1.1 * 4.8e-10 20.0 %
:HMM:PFM   35->218 PF07228 * SpoIIE 6.4e-17 18.1 177/193  
:BLT:SWISS 8->196 SP2E_BACSU 3e-05 25.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50112.1 GT:GENE ABO50112.1 GT:PRODUCT Stage II sporulation E family protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1723767..1724918) GB:FROM 1723767 GB:TO 1724918 GB:DIRECTION - GB:PRODUCT Stage II sporulation E family protein GB:NOTE PFAM: Stage II sporulation E family protein SMART: protein phosphatase 2C domain protein KEGG: tte:TTE0698 hypothetical protein GB:PROTEIN_ID ABO50112.1 GB:DB_XREF GI:134052141 InterPro:IPR001932 InterPro:IPR010822 LENGTH 383 SQ:AASEQ MKIYLDIGVAQLKKYGEELCGDSVEIVRTTQADLVVLSDGLGSGVKANILSRLTTKTAATMLRMGGNIDEVIDTVAKTLPIDKTIHAAYSTFSILQVQNNGKLHLVEYDNPGAFIGNQNTLFTPRREERTIAGKKIREYDFEVDDHDWLVLTSDGVLNAGTNGQMNVNWGWDRMSRFIEDSYAPDKTASEWSEEIVGLCNSLYGEQPGDDVTVVAVKVRHPVHVTLLIGPPKQREDDRRVVRKLMESPGAKVICGGTTGEIVGRVLGRKVFVDISSVVEGIPPVGMLPGIDLITEGAVTLVQTLEHIKGNTKLKDLKDGKDGASRLATLLRSADSIHIMVGRAQNDALDCNDVPAIYAYKHHVIRDLINSLREIGKEITEEYF GT:EXON 1|1-383:0| BL:SWS:NREP 1 BL:SWS:REP 8->196|SP2E_BACSU|3e-05|25.7|183/827| SEG 211->225|vtvvavkvrhpvhvt| SEG 312->322|klkdlkdgkdg| RP:PDB:NREP 1 RP:PDB:REP 82->155|3e1iB|7e-04|19.4|72/298| HM:PFM:NREP 1 HM:PFM:REP 35->218|PF07228|6.4e-17|18.1|177/193|SpoIIE| HM:SCP:REP 3->220|1txoA_|4.8e-10|20.0|195/0|d.219.1.1|1/1|PP2C-like| OP:NHOMO 37 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------111-------------------------------------------------------------------------------------------------------------------------------------1---1111111-1-1-------1-1----------11-21--111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------2--------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 72 STR:RPRED 18.8 SQ:SECSTR #################################################################################ccEEEEEEEEEEEccGGGTTcEEEEEEEEccHHHHccTTccTHHHHTTccTTcccccTTc##cccccccccTTc#################################################################################################################################################################################################################################### PSIPRED cEEEEEEEEEEccccccEEccEEEEEEEcccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccEEEEEEEEEEEccccEEEEEEccccEEEEEccEEEEEEccccccccccccEEEEEEccccEEEEEEccEEEccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccEEEEEEEEcccEEEEEEccccccHHHHHHHHHHHHHccccEEEcccHHHHHHHHHHccEEEEEEEcccccccccEEEccHHHHHHHHHHHHHHHHHHcccccHHHHHccccHHHHHHHHHHccccEEEEEEEcccHHHHcccccccHHHHHHHHHHHHHHHHHcccEEEEEcc //