[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50116.1
DDBJ      :             ABC transporter related
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  907/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:307 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   4->217 3dhwC PDBj 1e-30 36.4 %
:RPS:PDB   4->221 3b5jA PDBj 2e-41 19.8 %
:RPS:SCOP  5->224 1b0uA  c.37.1.12 * 6e-42 25.5 %
:HMM:SCOP  4->234 1g2912 c.37.1.12 * 6.9e-59 35.5 %
:RPS:PFM   44->164 PF00005 * ABC_tran 2e-15 39.5 %
:HMM:PFM   44->164 PF00005 * ABC_tran 1.6e-22 40.9 115/118  
:HMM:PFM   33->54 PF03205 * MobB 0.00029 45.5 22/137  
:BLT:SWISS 4->222 YBHF_SHIFL 3e-59 47.5 %
:BLT:SWISS 196->299 CAPP_PROMP 9e-04 27.7 %
:PROS 136->150|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50116.1 GT:GENE ABO50116.1 GT:PRODUCT ABC transporter related GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1728730..1729653 GB:FROM 1728730 GB:TO 1729653 GB:DIRECTION + GB:PRODUCT ABC transporter related GB:NOTE PFAM: ABC transporter related SMART: AAA ATPase KEGG: swo:Swol_2448 ABC transporter-related protein GB:PROTEIN_ID ABO50116.1 GB:DB_XREF GI:134052145 InterPro:IPR003439 InterPro:IPR003593 LENGTH 307 SQ:AASEQ MDYVVETNDLTRTFGSFTAVNKLTIKIRPGEIYGFLGPNGSGKSTTIRMLCGILEPTSGSGRVLGYDLASESEQIKSRIGYMSQKFSLYDDLTVQENLSFYAGLYSVPRPERKTRIEEMIEMACLTGREKELVVNLSLGWKQRLALGCAILSKPAIIFLDEPTSGISPTSRKMFFNIIQGLANAGTTIMVTTHFMDEAERCSNIAFISEGHLIANDTPDNLRNNVLEGVLAEVATNNPMDRLPVVEALPYVKECSVHGSLLHVLVQSEENLSELQQHTAGNIKKITPSLEDVFIALSRQRRRGSANE GT:EXON 1|1-307:0| BL:SWS:NREP 2 BL:SWS:REP 4->222|YBHF_SHIFL|3e-59|47.5|219/578| BL:SWS:REP 196->299|CAPP_PROMP|9e-04|27.7|94/100| PROS 136->150|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 4->217|3dhwC|1e-30|36.4|214/343| RP:PDB:NREP 1 RP:PDB:REP 4->221|3b5jA|2e-41|19.8|217/243| RP:PFM:NREP 1 RP:PFM:REP 44->164|PF00005|2e-15|39.5|119/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 44->164|PF00005|1.6e-22|40.9|115/118|ABC_tran| HM:PFM:REP 33->54|PF03205|0.00029|45.5|22/137|MobB| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 5->224|1b0uA|6e-42|25.5|220/258|c.37.1.12| HM:SCP:REP 4->234|1g2912|6.9e-59|35.5|231/240|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 47528 OP:NHOMOORG 1172 OP:PATTERN TTIAPMGIPPPLQLTJfGQOJOPawMPbhVcVIBEDDBHEHDCTaLYhLS*wf9OePUYNOFGCV169 SawO*edgkkoYbXZSTML-LjAAd*NNNNNSqonqz***V*Z*p*sjvgcQ*wxOVbEEyx*l*w****fYSSS*bXbQ*ghC5B7APPRP5OFIG--EHRJMKeMcSU677777778A9999DROHQXKLURXPhnnv*KKK*eulr*ihlciSTJHKHMJhgZk***bHPFJHGGNEIGFkadWToc7Tiu*******************z****drx**hrttxsqv**ZijkhkgghhiiihgYcXcb*aXV**UNZUettPQ**eUQVeeegholqroluwvwruqsmprwospbcbaZbbbgbbaa*klaZZnlops*p*********k*hs***dijf*sgmj*krUI**mhaehfTceUfoNUVZKeUSSLLMKILZU***ZSt****************-nu*lf*l***RD**************FLK**********POPPPPPPubfKSmZ*77577777556798BB89BA9999A98A8KEDEDE***y*********y*u********m********AP*zp*lrik******YjlLVMPiVHHHHIHHPTScrjb**QbU*fVgqZYlIgacSTagVXcdcfs*Y*IKNRDHHHIFD89A9BAAAAGNDGFJImmrNrYjLRMsPUVWVOUaVTTTUVZVVca5-BKVPN21-111*u**U*toqqpptpumn-qonoqmqpopruoklnlkq*****jkbkjgihjijlhghlhig*gddkkjkP5************34IHCEDDDKKLLPJ*m*UVTZUXELOKJOMQdLMNMMFQHLSoeywwxz***o****i***CDDBCDDCDLhljxnnnony*uyxUUPPPQPNOPFFFF87OSTTHILL78888887*EUA8A7B-99C8FA8DFD8CG987556TljPMewenfChJ 1144rnI-RE7GUgVLIIHNSYQcThXKKCFBFPKLHKFGFHHFECRJKRTUdXPJNBIHHHH7BAAA4897BDBBD2CEG978CH57-LTGIIDJAA98CAHNOL7SpphTWVdZZIIFCKXJmqBvJ**n4pUrJIHAdGJlXCNDFGZFD*GTNOoHc*NlJhFyYZ*hfUIHLEG*DIDNR*yu*K**LJ****b ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 296-308| PSIPRED cccEEEEEEEEEEEccEEEEcccEEEEcccEEEEEEccccccHHHHHHHHHccccccccEEEEccccccccHHHHHHHccEEcccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHccHHHHccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHccEEEEEEccEEEEEccHHHHHHHHcccEEEEEEEcccHHHHHHHHHccccEEEEEcccEEEEEEccHHHHHHHHHHHHcccEEccccHHHHHHHHHHHHHHccccc //