[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50138.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  74/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:297 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   70->284 PF08812 * YtxC 2e-37 42.5 %
:HMM:PFM   67->284 PF08812 * YtxC 7.4e-79 46.8 218/221  
:BLT:SWISS 68->287 YTXC_BACSU 5e-18 26.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50138.1 GT:GENE ABO50138.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1750597..1751490 GB:FROM 1750597 GB:TO 1751490 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: sth:STH2563 hypothetical protein GB:PROTEIN_ID ABO50138.1 GB:DB_XREF GI:134052167 LENGTH 297 SQ:AASEQ MSQCFSIGATRHIDLLKDKLGRELPLNEGNNLIVKLTEKPIGNITFLSFDFNGALCCGGPLEDELLFRHFVADIISDLILNQWEKAIMADVIKENYFFFNEDEKKIIYQYSQDYAKGERVFIGCMDRLDRKNLIIKRLVEFLEQSNNLVIDGFIRFRLKDYINEIKEAVDQAVDDFLMEREYREFIQLLKYFVEIQDSKVDVVNVLMNQRGTYKLYDENNEPISSEFLEGFILDIMDNEINYEDLLISALITMAPNKIVFHFGASHKPETTIDTIKHVFEGKVEECPGCKLCQNQQQ GT:EXON 1|1-297:0| BL:SWS:NREP 1 BL:SWS:REP 68->287|YTXC_BACSU|5e-18|26.5|215/281| RP:PFM:NREP 1 RP:PFM:REP 70->284|PF08812|2e-37|42.5|212/220|YtxC| HM:PFM:NREP 1 HM:PFM:REP 67->284|PF08812|7.4e-79|46.8|218/221|YtxC| OP:NHOMO 75 OP:NHOMOORG 75 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-111111111111111111111111111-1--------11------------------------------------------------------------------------------------------11111111111111111111111-11--1--1111111111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,294-298| PSIPRED cccEEEccccccHHHHHHHHHHHHHHcccccEEEEEEccccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcHHHHHHHHccccHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccEEEEEcccccccHHHHHHHHHHHHcccccHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHcccEEEcccccccccccc //