[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50143.1
DDBJ      :             LSU ribosomal protein L20P
Swiss-Prot:RL20_DESRM   RecName: Full=50S ribosomal protein L20;

Homologs  Archaea  0/68 : Bacteria  909/915 : Eukaryota  55/199 : Viruses  0/175   --->[See Alignment]
a.144.2
:118 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->118 1vs6Q PDBj 3e-33 69.8 %
:RPS:PDB   1->116 3bboS PDBj 5e-31 33.6 %
:RPS:SCOP  3->118 1vs6Q1  a.144.2.1 * 5e-35 59.5 %
:HMM:SCOP  61->120 1gyzA_ a.144.2.1 * 2.6e-24 66.7 %
:RPS:PFM   3->106 PF00453 * Ribosomal_L20 2e-23 59.6 %
:HMM:PFM   3->109 PF00453 * Ribosomal_L20 1.7e-51 71.0 107/108  
:BLT:SWISS 1->118 RL20_DESRM 4e-54 100.0 %
:PROS 54->70|PS00937|RIBOSOMAL_L20
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50143.1 GT:GENE ABO50143.1 GT:PRODUCT LSU ribosomal protein L20P GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1755440..1755796 GB:FROM 1755440 GB:TO 1755796 GB:DIRECTION + GB:PRODUCT LSU ribosomal protein L20P GB:NOTE TIGRFAM: ribosomal protein L20 KEGG: chy:CHY_1576 ribosomal protein L20 GB:PROTEIN_ID ABO50143.1 GB:DB_XREF GI:134052172 InterPro:IPR005812 InterPro:IPR005813 LENGTH 118 SQ:AASEQ MPRAKSSVVSRNRHRKILKLAKGYRGSRSKLFRVANQAVMKGLFYAYRDRRQKKRDFRKLWIARINAATRMNGLSYSRFINGLKKAGVEVNRKMLADLAVNDAKAFGQLVELAKSKLA GT:EXON 1|1-118:0| SW:ID RL20_DESRM SW:DE RecName: Full=50S ribosomal protein L20; SW:GN Name=rplT; OrderedLocusNames=Dred_1615; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->118|RL20_DESRM|4e-54|100.0|118/118| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 54->70|PS00937|RIBOSOMAL_L20|PDOC00722| SEG 48->59|rdrrqkkrdfrk| BL:PDB:NREP 1 BL:PDB:REP 3->118|1vs6Q|3e-33|69.8|116/117| RP:PDB:NREP 1 RP:PDB:REP 1->116|3bboS|5e-31|33.6|116/119| RP:PFM:NREP 1 RP:PFM:REP 3->106|PF00453|2e-23|59.6|104/108|Ribosomal_L20| HM:PFM:NREP 1 HM:PFM:REP 3->109|PF00453|1.7e-51|71.0|107/108|Ribosomal_L20| GO:PFM:NREP 5 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00453|IPR005813| GO:PFM GO:0005622|"GO:intracellular"|PF00453|IPR005813| GO:PFM GO:0005840|"GO:ribosome"|PF00453|IPR005813| GO:PFM GO:0006412|"GO:translation"|PF00453|IPR005813| GO:PFM GO:0019843|"GO:rRNA binding"|PF00453|IPR005813| RP:SCP:NREP 1 RP:SCP:REP 3->118|1vs6Q1|5e-35|59.5|116/117|a.144.2.1| HM:SCP:REP 61->120|1gyzA_|2.6e-24|66.7|60/60|a.144.2.1|1/1|Ribosomal protein L20| OP:NHOMO 986 OP:NHOMOORG 964 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 ----2------------------------------------------------------------------------------------------------------111-1111--1----1-11-1-122---1---11111-1----1--3-1--1--------111---2211217111111322-141111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 100.0 SQ:SECSTR ccccccTTHHHHHHHHHHHHcccccccTTccHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHHHTcccccccGGGGTTccTTTTTHHHHHHHHHcc DISOP:02AL 1-1,118-119| PSIPRED cccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHccHHHHHHHHHHHHHHHc //