[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50152.1
DDBJ      :             transposase IS116/IS110/IS902 family protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  94/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:411 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   124->410 3bnyA PDBj 8e-05 12.6 %
:RPS:SCOP  1->73 2ch5A2  c.55.1.5 * 6e-04 20.5 %
:RPS:PFM   90->167 PF01548 * Transposase_9 1e-04 32.4 %
:RPS:PFM   282->366 PF02371 * Transposase_20 1e-12 42.9 %
:HMM:PFM   282->368 PF02371 * Transposase_20 4.5e-27 37.2 86/87  
:HMM:PFM   89->161 PF01548 * Transposase_9 1.9e-13 37.0 73/96  
:HMM:PFM   140->278 PF09665 * RE_Alw26IDE 0.00024 19.2 130/511  
:BLT:SWISS 6->405 YI11_STRCL 1e-13 26.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50152.1 GT:GENE ABO50152.1 GT:PRODUCT transposase IS116/IS110/IS902 family protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1766727..1767962 GB:FROM 1766727 GB:TO 1767962 GB:DIRECTION + GB:PRODUCT transposase IS116/IS110/IS902 family protein GB:NOTE PFAM: transposase, IS111A/IS1328/IS1533; transposase IS116/IS110/IS902 family protein KEGG: dsy:DSY4536 hypothetical protein GB:PROTEIN_ID ABO50152.1 GB:DB_XREF GI:134052181 InterPro:IPR002525 InterPro:IPR003346 LENGTH 411 SQ:AASEQ MSQMLVGIDVSLQSHHVQFMDGDGGALASFSIHNNRQGADTLIQKIVDTSDRIKSQSLRIGMEATSNLGWHLAHYLQEQLQTTCPQKDTQIYVLNARKVARFKKGYDTLPKNDRIDAWVIADHLRFGRLPHAMKDIIQYEALQRLTRTRFHLMQNITRDKTYFLNQVFLKFSGLRQDNPFSNLFGSTCLAVIQELEPEQIVAMSMEELVDFLKDKGKNRFDNPEEIALYLQKIARSSYRLNKAMADPVNISLATMLNVIKHMESEVKKLDKEIAKIMKGLPQTLTSVKGIGDVFTAGIMAETGDIQRFKDHNALAKYAGLTWNQHQSGEFEAEDTSRTRTGNKYLRYYLIQAADSVRKHVPEYKDFYQKKYDEVPKHKHKRALVLTARKLVRLVFSLLNTRQLYTSPERRG GT:EXON 1|1-411:0| BL:SWS:NREP 1 BL:SWS:REP 6->405|YI11_STRCL|1e-13|26.0|365/399| RP:PDB:NREP 1 RP:PDB:REP 124->410|3bnyA|8e-05|12.6|270/294| RP:PFM:NREP 2 RP:PFM:REP 90->167|PF01548|1e-04|32.4|74/95|Transposase_9| RP:PFM:REP 282->366|PF02371|1e-12|42.9|84/87|Transposase_20| HM:PFM:NREP 3 HM:PFM:REP 282->368|PF02371|4.5e-27|37.2|86/87|Transposase_20| HM:PFM:REP 89->161|PF01548|1.9e-13|37.0|73/96|Transposase_9| HM:PFM:REP 140->278|PF09665|0.00024|19.2|130/511|RE_Alw26IDE| GO:PFM:NREP 6 GO:PFM GO:0003677|"GO:DNA binding"|PF01548|IPR002525| GO:PFM GO:0004803|"GO:transposase activity"|PF01548|IPR002525| GO:PFM GO:0006313|"GO:transposition, DNA-mediated"|PF01548|IPR002525| GO:PFM GO:0003677|"GO:DNA binding"|PF02371|IPR003346| GO:PFM GO:0004803|"GO:transposase activity"|PF02371|IPR003346| GO:PFM GO:0006313|"GO:transposition, DNA-mediated"|PF02371|IPR003346| RP:SCP:NREP 1 RP:SCP:REP 1->73|2ch5A2|6e-04|20.5|73/117|c.55.1.5| OP:NHOMO 428 OP:NHOMOORG 101 OP:PATTERN ------------5I-1----------------------------------527--------------- --------11-1----1---------------------1---------------------------1--------5----11-----------------------------------------------1-----6----------2---------------------------------------------3--------112-1-1-1-----11112------------1-------1-1----1-DC--11-C1-7---------------------------------2----1---------------45---655-1---5----------1-66------A5-114--CA7D32-E5-448125--1---------------1-------------------1-----------1--2--25-------------5----------------1-------------------------------------------------------66---------9------1-------------------------------------8--------------2-----2----------------------------------8-------------------1---1-----------------------------------1-------------------------------------------------------7--------------------------------------------------------------1-----------------------------------7--------------------a2------------------------------------8-98--------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 270 STR:RPRED 65.7 SQ:SECSTR ###########################################################################################################################cccccccccccccTTHHHHHHHHHHHHccccHHHHHHHcHHHHHHHTccTTTH######HHHHHHHHHHHHHH#HHHTTccHHHHHHHHHHH##HHHHHTcccccTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHTccccccccccHHHHHHTcHHHHHHHHHH#####HHHHTccccHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHccccc###HHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHcGG# DISOP:02AL 103-111,329-339,405-412| PSIPRED ccEEEEEEEccccEEEEEEEcccccEEEEEEEcccHHHHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHHHHHHHHcccEEEEEcHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccccccccHHHHHHHHcccHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHcccHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccHHHcc //