[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50156.1
DDBJ      :             CRISPR-associated protein, Csm2 family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:169 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   61->164 PF03750 * DUF310 3e-06 30.8 %
:HMM:PFM   61->166 PF03750 * DUF310 1.2e-12 22.3 103/119  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50156.1 GT:GENE ABO50156.1 GT:PRODUCT CRISPR-associated protein, Csm2 family GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1773382..1773891 GB:FROM 1773382 GB:TO 1773891 GB:DIRECTION + GB:PRODUCT CRISPR-associated protein, Csm2 family GB:NOTE TIGRFAM: CRISPR-associated protein, Csm2 family GB:PROTEIN_ID ABO50156.1 GB:DB_XREF GI:134052185 InterPro:IPR010149 LENGTH 169 SQ:AASEQ MSDWKKQLQGYKDKQGNRNQPHQGKRDKNDMGYQRYTTPGLPDGYLSKGYFDDQGCLLEILLTETASKIAKSFGSNMNNSQLRRFYGHAKTAEKSYAFSGDERKFINDIKALDSFVAEAKGKDKVPQIFYDFINVNVAKANSLKDIKQGFLPHFQAVVAYFTYHYPKSK GT:EXON 1|1-169:0| RP:PFM:NREP 1 RP:PFM:REP 61->164|PF03750|3e-06|30.8|104/118|DUF310| HM:PFM:NREP 1 HM:PFM:REP 61->166|PF03750|1.2e-12|22.3|103/119|DUF310| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,6-31,167-170| PSIPRED cccHHHHHHccccccccccccccccccHHcccHHHcccccccccccccccccccccEEHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccHHcccHHHHHHHHHHHHHHHHHHHHHHHccccc //