[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50161.1
DDBJ      :             protein of unknown function DUF710
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  60/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.244.1
:90 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->84 3hnwA PDBj 2e-04 26.7 %
:RPS:SCOP  8->80 1t3uA  d.244.1.1 * 7e-14 19.2 %
:HMM:SCOP  7->81 1t3uA_ d.244.1.1 * 2.4e-16 33.3 %
:RPS:PFM   7->78 PF05164 * ZapA 4e-08 38.9 %
:HMM:PFM   7->78 PF05164 * ZapA 3.8e-22 47.2 72/89  
:BLT:SWISS 4->86 ZAPA_GEOSW 3e-18 45.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50161.1 GT:GENE ABO50161.1 GT:PRODUCT protein of unknown function DUF710 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1777779..1778051 GB:FROM 1777779 GB:TO 1778051 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF710 GB:NOTE PFAM: protein of unknown function DUF710 KEGG: swo:Swol_1104 hypothetical protein GB:PROTEIN_ID ABO50161.1 GB:DB_XREF GI:134052190 InterPro:IPR007838 LENGTH 90 SQ:AASEQ MSNQANRVEVEIFGEYYTLKGHESPEYMLKVAHLVNKKMMEISERNPILSSNKVAVLTVVNLIDELLKLQEQYNNLLQMMDPEKGDSSNS GT:EXON 1|1-90:0| BL:SWS:NREP 1 BL:SWS:REP 4->86|ZAPA_GEOSW|3e-18|45.8|83/87| BL:PDB:NREP 1 BL:PDB:REP 9->84|3hnwA|2e-04|26.7|75/124| RP:PFM:NREP 1 RP:PFM:REP 7->78|PF05164|4e-08|38.9|72/124|ZapA| HM:PFM:NREP 1 HM:PFM:REP 7->78|PF05164|3.8e-22|47.2|72/89|ZapA| RP:SCP:NREP 1 RP:SCP:REP 8->80|1t3uA|7e-14|19.2|73/92|d.244.1.1| HM:SCP:REP 7->81|1t3uA_|2.4e-16|33.3|75/92|d.244.1.1|1/1|Cell division protein ZapA-like| OP:NHOMO 60 OP:NHOMOORG 60 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111-1--------1----------------1111------------------------------------------------------------------------11--1111111-1-1-111----11-----11--1111-1-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 75 STR:RPRED 83.3 SQ:SECSTR ########EEEETTEEEEEcccccHHHHHHHHHHHHHHHHHHTTcHHHHTcHHHHH#HHHHHHHHHHHHHHHHHHHHHHHHHHH###### DISOP:02AL 1-5,8-8,42-49,76-91| PSIPRED ccccccEEEEEEccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //