[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50178.1
DDBJ      :             protein of unknown function UPF0153
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:242 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   25->111 PF03692 * UPF0153 6e-09 37.2 %
:HMM:PFM   15->105 PF03692 * UPF0153 1e-10 30.4 69/85  
:BLT:SWISS 76->134 SYT_FLAPJ 9e-04 30.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50178.1 GT:GENE ABO50178.1 GT:PRODUCT protein of unknown function UPF0153 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1804602..1805330 GB:FROM 1804602 GB:TO 1805330 GB:DIRECTION + GB:PRODUCT protein of unknown function UPF0153 GB:NOTE PFAM: protein of unknown function UPF0153 KEGG: cte:CT0872 hypothetical protein GB:PROTEIN_ID ABO50178.1 GB:DB_XREF GI:134052207 InterPro:IPR005358 LENGTH 242 SQ:AASEQ MSKNLKSTDTFNFSCHEGLSCFKQCCRDINIFLTPYDVLRMKQSLGMVSGEFLNMYTHVMRVPGSGFPVVILKMREDNLVCPFITDYGCKVYNVRPWSCRMAPIEVRGEGLYGVAFEKSHCHGLEESRRWTVEEWMKNQGLYEYQEPEELFGQIPLKIRLTGEKSADQHIMDMIFMGCYDLDRFREILTANPSIVQNSQIEVDIKDDLSLMKFAFRWLPEQLNDSKQRQVLRAIVDKQRTNS GT:EXON 1|1-242:0| BL:SWS:NREP 1 BL:SWS:REP 76->134|SYT_FLAPJ|9e-04|30.5|59/648| RP:PFM:NREP 1 RP:PFM:REP 25->111|PF03692|6e-09|37.2|78/94|UPF0153| HM:PFM:NREP 1 HM:PFM:REP 15->105|PF03692|1e-10|30.4|69/85|UPF0153| OP:NHOMO 32 OP:NHOMOORG 22 OP:PATTERN -----------------------1-------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------11--1--1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--22--------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------4231--1111111-----------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,157-169,235-235,237-243| PSIPRED ccccccccccEEEEEEccccHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHccEEEEEccccEEEEEEccccccccEEEcccccEEEccccHHHccccEEEcccccEEEEEcccccccccccccccHHHHHHHcccHHHHcccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEHHHHHHHHccc //