[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50187.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:206 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50187.1 GT:GENE ABO50187.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1817269..1817889 GB:FROM 1817269 GB:TO 1817889 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: swo:Swol_1434 hypothetical protein GB:PROTEIN_ID ABO50187.1 GB:DB_XREF GI:134052216 LENGTH 206 SQ:AASEQ MLRRLFYLGLVGIILLFITGITLGGEELLGKGHVNYLSALQVFAQPNQPAIEPDSVIREENVFLCGDIEEVARKNTSTLKIKDVKDIESLYTDQGYTLSYHNKEILAQRKVKEFCSYHRNFRHLGIYNNKLAVFQGPLGYNQKLIRVENTIPVESLSAGFQVKLQQSMDFFQMTPETQAVLRYELEFAGEEALNAILENLDEFQAE GT:EXON 1|1-206:0| TM:NTM 1 TM:REGION 5->26| SEG 8->30|lglvgiillfitgitlggeellg| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,204-207| PSIPRED cHHHHHHHHHHHHHHHHHHcccccHHHHHccccHHHHHHHHHHHccccccccHHHHcccccEEEEccHHHHHHccccEEEEEEHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHHcccEEEEEEccEEEEEEcccccccEEEEEEccccHHHccccEEEEEcccccHHHccccccEEEEEEEEcccHHHHHHHHHHHHHHHcc //