[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50191.1
DDBJ      :             protein of unknown function DUF208
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  255/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.26.2
:185 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->109 2d13C PDBj 2e-04 7.9 %
:RPS:SCOP  25->146 1gpmA1  c.26.2.1 * 5e-05 16.0 %
:RPS:PFM   4->173 PF02677 * DUF208 6e-37 45.6 %
:HMM:PFM   4->172 PF02677 * DUF208 1.9e-66 48.8 168/176  
:BLT:SWISS 3->172 Y882_HAEIN 4e-25 36.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50191.1 GT:GENE ABO50191.1 GT:PRODUCT protein of unknown function DUF208 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1820197..1820754 GB:FROM 1820197 GB:TO 1820754 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF208 GB:NOTE PFAM: protein of unknown function DUF208 KEGG: swo:Swol_1430 conserved hypothetical cytosolic protein GB:PROTEIN_ID ABO50191.1 GB:DB_XREF GI:134052220 InterPro:IPR003828 LENGTH 185 SQ:AASEQ MKKLLLHTCCGPCAIHPLDELRSKGFEVFGLFYNPNIHPYTEFKKRRDQLEEYAQQQNWKVIFDEEYRLDEYLHEVIHRETKRCQLCYNMRLKKAAQMAKKGNFDAFSTTLLVSPFQKHDLIRELGENLAEQYGVPFYYQDFRPGYKEATIKSKELEMYRQQYCGCIYSERDRYYRPVKKKVGER GT:EXON 1|1-185:0| BL:SWS:NREP 1 BL:SWS:REP 3->172|Y882_HAEIN|4e-25|36.1|169/100| RP:PDB:NREP 1 RP:PDB:REP 1->109|2d13C|2e-04|7.9|101/209| RP:PFM:NREP 1 RP:PFM:REP 4->173|PF02677|6e-37|45.6|169/176|DUF208| HM:PFM:NREP 1 HM:PFM:REP 4->172|PF02677|1.9e-66|48.8|168/176|DUF208| RP:SCP:NREP 1 RP:SCP:REP 25->146|1gpmA1|5e-05|16.0|119/175|c.26.2.1| OP:NHOMO 260 OP:NHOMOORG 258 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1111-11111---1--------1----------------------------------------111--------------------------------------------111-------------------------------------------11111111111111-111-------------------1----11111111111-------------1111111111111-11---111-1--111-1--1----1-11------111-1111--1111--1----1111-1---------------11111--1-------------------------------------------------------------------------------1111111111111---------111111---------------------1-----1----------1-----11-------111111111-----111111-1111111111111111------11111111111111111111111111111-------1------------------------1----------11----1-------1---------1---------1-----1111-----------------112-11111-----------------111111111-----1111111111-11111111111----------------------------------------------111-1--1111111-1-1--------------1---------------------------11111111111-- ------------------------------------------------------------------------------------------------------------2-------------------------------------------------------------------------------------1---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 101 STR:RPRED 54.6 SQ:SECSTR TTEEEEEccccHHHHHHHHHHHHTTcEEEEEEEEEcccHHHHHHHHHcEEEEEcccHHHHHHHHHHTccccEEE########ccccccHHHHHHHHHHHHHHTcEEEcT############################################################################ DISOP:02AL 177-186| PSIPRED ccEEEEEEEcccccHHHHHHHHHcccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHcccEEEcccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccHHHccccccccHHHHHHHHHHHHHHcccEEccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHccHHHHHHccc //