[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50196.1
DDBJ      :             metal dependent phosphohydrolase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.211.1
:220 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   64->171 2b90A PDBj 5e-07 8.7 %
:RPS:SCOP  12->134 2pq7A1  a.211.1.1 * 2e-11 25.9 %
:HMM:SCOP  25->116 1u6zA1 a.211.1.5 * 7.9e-12 26.4 %
:HMM:PFM   35->134 PF01966 * HD 3.2e-11 26.0 96/118  
:BLT:SWISS 25->141 Y1020_METJA 6e-05 27.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50196.1 GT:GENE ABO50196.1 GT:PRODUCT metal dependent phosphohydrolase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1823841..1824503 GB:FROM 1823841 GB:TO 1824503 GB:DIRECTION + GB:PRODUCT metal dependent phosphohydrolase GB:NOTE PFAM: metal-dependent phosphohydrolase, HD sub domain KEGG: chy:CHY_1513 HDIG domain protein, ambiguity GB:PROTEIN_ID ABO50196.1 GB:DB_XREF GI:134052225 InterPro:IPR006674 LENGTH 220 SQ:AASEQ MSITLEDVKANPIVDSCIRKGNEYLGVMGFTEHSYRHINLVSSIARNILEKLGRPKRECELAAIAGYMHDVGNVISRNDHGISGANIAFNLLLNMGMPPDEVCTVASAIANHEEQYGYPVNAVSAALIVADKSDVHRSRVRNQDFATFDIHDRVNYAASHAFVYVNDDKHTITMELNIDIEICPVMEYFEIFLSRMILCRRAANYLGCNFELVINGAKLL GT:EXON 1|1-220:0| BL:SWS:NREP 1 BL:SWS:REP 25->141|Y1020_METJA|6e-05|27.8|115/259| RP:PDB:NREP 1 RP:PDB:REP 64->171|2b90A|5e-07|8.7|104/129| HM:PFM:NREP 1 HM:PFM:REP 35->134|PF01966|3.2e-11|26.0|96/118|HD| RP:SCP:NREP 1 RP:SCP:REP 12->134|2pq7A1|2e-11|25.9|116/174|a.211.1.1| HM:SCP:REP 25->116|1u6zA1|7.9e-12|26.4|91/0|a.211.1.5|1/1|HD-domain/PDEase-like| OP:NHOMO 19 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--1-111111112--11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 138 STR:RPRED 62.7 SQ:SECSTR ###############################ccHHHHHHHHHHHHHHHHHHHHHTTcccHHHHTcTHHHHHHHHHHHHHTcccccTTcEEcGGGccccccHHHHHHHHHHHHHHHHHHHHHTTcTTTccccHHHHHHHHHHHHHHHHH##HHHHHHHHcccccccccccEE################################################# DISOP:02AL 1-1| PSIPRED ccEEHHHHHccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccHHHHHHHHHcccccHHHHHHccccccccHHHHHHHHHHHEEEEEcccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccEEc //