[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50205.1
DDBJ      :             major facilitator superfamily MFS_1
Swiss-Prot:             

Homologs  Archaea  21/68 : Bacteria  367/915 : Eukaryota  19/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:474 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   31->92 2gfpA PDBj 3e-05 27.4 %
:RPS:SCOP  17->385 1pw4A  f.38.1.1 * 2e-15 14.0 %
:HMM:SCOP  1->406 1pw4A_ f.38.1.1 * 5.7e-74 28.2 %
:RPS:PFM   31->342 PF07690 * MFS_1 5e-21 29.6 %
:HMM:PFM   27->311 PF07690 * MFS_1 4.3e-48 28.7 275/353  
:HMM:PFM   296->417 PF07690 * MFS_1 7.7e-20 24.8 121/353  
:BLT:SWISS 15->384 YITG_BACSU 7e-83 46.1 %
:PROS 72->88|PS00216|SUGAR_TRANSPORT_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50205.1 GT:GENE ABO50205.1 GT:PRODUCT major facilitator superfamily MFS_1 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1831933..1833357) GB:FROM 1831933 GB:TO 1833357 GB:DIRECTION - GB:PRODUCT major facilitator superfamily MFS_1 GB:NOTE PFAM: General substrate transporter; major facilitator superfamily MFS_1 KEGG: bld:BLi02158 similar to multidrug resistance protein GB:PROTEIN_ID ABO50205.1 GB:DB_XREF GI:134052234 InterPro:IPR001958 InterPro:IPR005828 InterPro:IPR005829 InterPro:IPR007114 InterPro:IPR011701 LENGTH 474 SQ:AASEQ MSQAASTDIQENKVNKYTLAALAGVPLIMVLGNSMLIPVLPQMAKSLNVSQMQISLIITLFSVPAGLVIPFAGFLSDRFGRKKIIIPGLFLYGLGGLLAGAAALIFKENAFPWILGGRILQGIGAAGTAPIAMAFCGDLWKGKERAKSLGVIEASNGLGKVASPILGALIGLIAWWYIFFFFPVVIAVVILGVWFICKEPETNKQPKKVNEYVGSIKNIFKKKSPLLLTSFFAGSAALLILFGVLFFLSDYLEKKFGLDGVIKGAALAIPVLFMSTTSYVTGALIKKKIKLMKWLVVIGHGLIGASLVTLPLFNNVYIFFAGISVAGIGTGLVLPCLNTLITSSTNKDERGLVTSLYGSVRFLGVAAGPPLFGWLVEKGSDMMFWASASLAVISAVLAFFFIKVKAIQTSQGNNYDSSKQKQSKQTLIMPVKQPFIAYKSLAWHPESNLIVRKPMPQMKKERINEVGQVNTGES GT:EXON 1|1-474:0| BL:SWS:NREP 1 BL:SWS:REP 15->384|YITG_BACSU|7e-83|46.1|369/422| PROS 72->88|PS00216|SUGAR_TRANSPORT_1|PDOC00190| TM:NTM 10 TM:REGION 18->40| TM:REGION 53->75| TM:REGION 84->106| TM:REGION 116->138| TM:REGION 169->191| TM:REGION 224->246| TM:REGION 259->281| TM:REGION 290->312| TM:REGION 319->341| TM:REGION 382->403| SEG 93->104|glggllagaaal| SEG 178->190|iffffpvviavvi| SEG 284->298|likkkiklmkwlvvi| SEG 386->398|asaslavisavla| BL:PDB:NREP 1 BL:PDB:REP 31->92|2gfpA|3e-05|27.4|62/375| RP:PFM:NREP 1 RP:PFM:REP 31->342|PF07690|5e-21|29.6|301/347|MFS_1| HM:PFM:NREP 2 HM:PFM:REP 27->311|PF07690|4.3e-48|28.7|275/353|MFS_1| HM:PFM:REP 296->417|PF07690|7.7e-20|24.8|121/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 17->385|1pw4A|2e-15|14.0|365/434|f.38.1.1| HM:SCP:REP 1->406|1pw4A_|5.7e-74|28.2|401/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 595 OP:NHOMOORG 407 OP:PATTERN ------111111111-----------2---1---11--------2-1111111--------------- -21-1-----1---211----11112-----111111131------1--------1-------------------------------------------------1-11---------------------1--1-122211---1---1--------------1------1-------------21----11-422423223-2232324344243231124221222322441321222211222122--31221-----21222----1-112-111--------11-------------------------------------1----------11-11-111-----1--2143112113-1---------13--1---1-----1----3---11111111112-1--1-----1213--144-43321-111121--1--111------------1-1-----------11-------------------2--11---3245463211111112111111711-11---111---11-------1-11--1-11-1111111-1--11112-1--111221--111-11----1-----1------------------------33112---1-----1-----------------------------1---1-1111111111-1111111111111111111--11--211111111111111111-1111111-----------------1-----12121-11----------------222221-11-1-----211-11-1--121-211122121---11111123112------------------------------------------------------------11---11111--- ----------------------1---1211111-------------1---11-1--1-----1---------------------------------1--1------------2----------------------------------------------11-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 62 STR:RPRED 13.1 SQ:SECSTR ##############################HHHHHHHHHHHHHHTTcccTTHHHHHHHHHHHHHHHHHHTTHHHHHTTcccccccHHHHHHH############################################################################################################################################################################################################################################################################################################################################################################################## DISOP:02AL 1-15,202-209,406-424,460-460,465-467,469-475| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccHHHHHHHcccccccccccccccHHHHHHHHHHcccccccc //