[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50206.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  34/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:91 amino acids
:PSIPRED
:RPS:PFM   16->84 PF10942 * DUF2619 4e-10 56.5 %
:HMM:PFM   16->84 PF10942 * DUF2619 1.7e-32 65.2 69/69  
:BLT:SWISS 9->90 YQHV_BACSU 9e-16 45.1 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50206.1 GT:GENE ABO50206.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1833483..1833758 GB:FROM 1833483 GB:TO 1833758 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: mta:Moth_0117 hypothetical protein GB:PROTEIN_ID ABO50206.1 GB:DB_XREF GI:134052235 LENGTH 91 SQ:AASEQ MFFVTDKIVFAMAMLRCISASIELSAAFFMLKYGKVETALKINALLALVGPSVMILVMTLGLVGLAGKVSLSKLGIIFAGVALIFYGISRP GT:EXON 1|1-91:0| BL:SWS:NREP 1 BL:SWS:REP 9->90|YQHV_BACSU|9e-16|45.1|82/93| TM:NTM 3 TM:REGION 6->28| TM:REGION 41->63| TM:REGION 69->91| RP:PFM:NREP 1 RP:PFM:REP 16->84|PF10942|4e-10|56.5|69/69|DUF2619| HM:PFM:NREP 1 HM:PFM:REP 16->84|PF10942|1.7e-32|65.2|69/69|DUF2619| OP:NHOMO 34 OP:NHOMOORG 34 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111-11-11-11---------1---------------------------------------------------------------------------------------------------------------------------1--111-1--1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccc //