[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50227.1
DDBJ      :             guanylate kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  890/915 : Eukaryota  191/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:200 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->188 2ancD PDBj 1e-45 50.3 %
:RPS:PDB   1->91 2ah8A PDBj 3e-18 11.0 %
:RPS:SCOP  2->189 1jxmA2  c.37.1.1 * 5e-39 26.4 %
:HMM:SCOP  4->198 1kjwA2 c.37.1.1 * 1.2e-70 51.8 %
:RPS:PFM   7->182 PF00625 * Guanylate_kin 5e-46 51.1 %
:HMM:PFM   7->185 PF00625 * Guanylate_kin 1.2e-55 46.9 179/183  
:BLT:SWISS 3->188 KGUA_THETN 9e-63 59.1 %
:PROS 39->56|PS00856|GUANYLATE_KINASE_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50227.1 GT:GENE ABO50227.1 GT:PRODUCT guanylate kinase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1859044..1859646 GB:FROM 1859044 GB:TO 1859646 GB:DIRECTION + GB:PRODUCT guanylate kinase GB:NOTE KEGG: tte:TTE1511 guanylate kinase PFAM: guanylate kinase SMART: guanylate kinase/L-type calcium channel region GB:PROTEIN_ID ABO50227.1 GB:DB_XREF GI:134052256 InterPro:IPR000850 InterPro:IPR008144 InterPro:IPR008145 LENGTH 200 SQ:AASEQ MTRQGLLIVISGPSGAGKGTICQGLLKKNKDLCLSVSCTTRPVRPGEVDGVNYFFVSKEAFEKMISENELLEYARVYDNYYGTPLNFVEEKLSTGQDVILEIDIQGALQIKQKYPKGVLIFVVPPSLSLLQERLTKRGTDSAESINKRLQCVCDELKNTQRYDYLVVNDIVDNAVAQVESIINAERCRPANFDIKKFLDC GT:EXON 1|1-200:0| BL:SWS:NREP 1 BL:SWS:REP 3->188|KGUA_THETN|9e-63|59.1|186/206| PROS 39->56|PS00856|GUANYLATE_KINASE_1|PDOC00670| BL:PDB:NREP 1 BL:PDB:REP 4->188|2ancD|1e-45|50.3|185/204| RP:PDB:NREP 1 RP:PDB:REP 1->91|2ah8A|3e-18|11.0|91/233| RP:PFM:NREP 1 RP:PFM:REP 7->182|PF00625|5e-46|51.1|176/183|Guanylate_kin| HM:PFM:NREP 1 HM:PFM:REP 7->185|PF00625|1.2e-55|46.9|179/183|Guanylate_kin| RP:SCP:NREP 1 RP:SCP:REP 2->189|1jxmA2|5e-39|26.4|182/199|c.37.1.1| HM:SCP:REP 4->198|1kjwA2|1.2e-70|51.8|193/0|c.37.1.1|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 2050 OP:NHOMOORG 1081 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-1111111111111111111111111111111111111111--111111111111111111111-111111111111---111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111121-222222221122222122111111111111111111111111111111111111111111111111111111111111111111111222111111111111111111111111111111111111111111111111111111111111111-11111111111311111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111-1111111-11111111111111111111-111111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-----------111111-11111111111111111111111111111-11 11-1112-5221222-1111111-11-11111121211-1-11111112133222321211111111111111111111111111111-111111111111111111251BSRELPF86667C6ZR4Y5**E1ZDU7754G7AGA68567E65S9DB9C5AB46542Q56I56653454Q1111252241322311111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 198 STR:RPRED 99.0 SQ:SECSTR cccEEEEEEEEGGGTEEEEEEEEEEEcccccEEEEEEEEEEEcccccccccccEEEEEEEEEccTTcccEEEEEEEEEEEcccccTTcccHHHHHHHHHHcHccccHHHHHHHHHHTTcccccccccTTTcccccccGGGcHHHHHHHHHHHHHHHHHHHHHHEEEEcccHHHHHHHHHHHHHTTccccTTccccHHH## DISOP:02AL 1-3,135-144| PSIPRED ccccccEEEEEccccccHHHHHHHHHHHcccEEEEEEEEEccccccccccEEEEEccHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHccccEEEEccHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHHHHccHHccccHHHccc //