[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50232.1
DDBJ      :             methionyl-tRNA formyltransferase
Swiss-Prot:FMT_DESRM    RecName: Full=Methionyl-tRNA formyltransferase;         EC=2.1.2.9;

Homologs  Archaea  5/68 : Bacteria  899/915 : Eukaryota  173/199 : Viruses  0/175   --->[See Alignment]
b.46.1c.65.1
:317 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->302 2fmtA PDBj 4e-72 45.5 %
:RPS:PDB   1->299 2cfiA PDBj 5e-85 29.6 %
:RPS:SCOP  1->203 1s3iA2  c.65.1.1 * 8e-43 30.2 %
:RPS:SCOP  204->309 1fmtA1  b.46.1.1 * 6e-28 32.4 %
:HMM:SCOP  1->206 2blnA2 c.65.1.1 * 2e-72 49.8 %
:HMM:SCOP  204->309 1fmtA1 b.46.1.1 * 4.6e-29 36.2 %
:RPS:PFM   1->180 PF00551 * Formyl_trans_N 9e-34 44.2 %
:RPS:PFM   204->300 PF02911 * Formyl_trans_C 2e-18 41.2 %
:HMM:PFM   1->180 PF00551 * Formyl_trans_N 8.9e-52 36.2 177/181  
:HMM:PFM   204->302 PF02911 * Formyl_trans_C 1.4e-32 38.4 99/100  
:BLT:SWISS 1->317 FMT_DESRM 0.0 100.0 %
:PROS 132->155|PS00373|GART

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50232.1 GT:GENE ABO50232.1 GT:PRODUCT methionyl-tRNA formyltransferase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1863829..1864782 GB:FROM 1863829 GB:TO 1864782 GB:DIRECTION + GB:PRODUCT methionyl-tRNA formyltransferase GB:NOTE TIGRFAM: methionyl-tRNA formyltransferase PFAM: formyl transferase domain protein KEGG: gsu:GSU0130 methionyl-tRNA formyltransferase GB:PROTEIN_ID ABO50232.1 GB:DB_XREF GI:134052261 InterPro:IPR001555 InterPro:IPR002376 InterPro:IPR005793 InterPro:IPR005794 LENGTH 317 SQ:AASEQ MRIVFMGTPDFAATSLKALIDAGQQVVAVVTQPDKPKGRGRQVQPPPVKVLANEYKIPVLQPTSIKINEFQQTIEELKPECIVVVAYGKILPTEILELPPKGCINVHASLLPYYRGSAPIHWAIINGEEETGVTTMFMDKGMDTGDMILKSSVSIGPSDTVGAIHDKLASDGAKLLIETIHLLEEDCAPRIPQNHKLATYAPMLRKEHELIHWDLSAKDIHNHVRGMNPWPGTYTIWDNKILKIWQTTIPAHQNIDADPGTVLEVSPSGILVQTAGGQILIKELQLQGSRRMEVTEFLRGKQMSPGTVLGFEGGRGN GT:EXON 1|1-317:0| SW:ID FMT_DESRM SW:DE RecName: Full=Methionyl-tRNA formyltransferase; EC=2.1.2.9; SW:GN Name=fmt; OrderedLocusNames=Dred_1705; SW:KW Complete proteome; Methyltransferase; Protein biosynthesis;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->317|FMT_DESRM|0.0|100.0|317/317| GO:SWS:NREP 3 GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 132->155|PS00373|GART|PDOC00319| BL:PDB:NREP 1 BL:PDB:REP 1->302|2fmtA|4e-72|45.5|301/314| RP:PDB:NREP 1 RP:PDB:REP 1->299|2cfiA|5e-85|29.6|291/310| RP:PFM:NREP 2 RP:PFM:REP 1->180|PF00551|9e-34|44.2|172/179|Formyl_trans_N| RP:PFM:REP 204->300|PF02911|2e-18|41.2|97/100|Formyl_trans_C| HM:PFM:NREP 2 HM:PFM:REP 1->180|PF00551|8.9e-52|36.2|177/181|Formyl_trans_N| HM:PFM:REP 204->302|PF02911|1.4e-32|38.4|99/100|Formyl_trans_C| GO:PFM:NREP 4 GO:PFM GO:0009058|"GO:biosynthetic process"|PF00551|IPR002376| GO:PFM GO:0016742|"GO:hydroxymethyl-, formyl- and related transferase activity"|PF00551|IPR002376| GO:PFM GO:0009058|"GO:biosynthetic process"|PF02911|IPR005793| GO:PFM GO:0016742|"GO:hydroxymethyl-, formyl- and related transferase activity"|PF02911|IPR005793| RP:SCP:NREP 2 RP:SCP:REP 1->203|1s3iA2|8e-43|30.2|202/203|c.65.1.1| RP:SCP:REP 204->309|1fmtA1|6e-28|32.4|105/108|b.46.1.1| HM:SCP:REP 1->206|2blnA2|2e-72|49.8|203/0|c.65.1.1|1/1|Formyltransferase| HM:SCP:REP 204->309|1fmtA1|4.6e-29|36.2|105/108|b.46.1.1|1/1|FMT C-terminal domain-like| OP:NHOMO 1562 OP:NHOMOORG 1077 OP:PATTERN -------------------------------------------111----11---------------- 1121122222231321111-11221211111122221222112311212112212112221221323223211111111111211122211111111--11323121122111111111111111111111111213221111211-1111121111111111112111222111111111111111122112122222323223222311111122212221111111112211111111111111122222211112111112211222121211111111111111111111111111111111111111111111111111111111112211111111121311111112111111211212221221121111111111111111111111122222222221-12212213111112221121112211121111111112211111111111111111111111111111111111111111111111111112411222222222222223233332222222223222111111111111241111211111111211111221112111212211434431222111112111211112112312111111111111112212121111221111111111111111211-1111111111111222232222222222-222222222222222222222223252212222222222222122222222223222222222221131111111221112111111211111121111111111111112222122211111112211111111111111111111111111111111111111111111223211111111111----1-111-111---1111111112112221222121 ----1-----1-111111111-1111-11-111111-11111111111112-1--1--111111111111111111111111111111--1111111111--1111-1116233331332233132162AH3-456322142243142213125222232122322-32321141121171111123211121121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 317 STR:RPRED 100.0 SQ:SECSTR cEEEEEccHHHHHHHHHHHHHTTcEEEEEEEcccccccccccccccHHHHHHHHHTccEEEccccEETHHHHHHHHTcccEEEEccccccccHHHHTccTTcEEEEEcccTTTTccccHHHHHHHTTccEEEEEEEEcccccccccEEEEEEEEccTTccHHHHHHHTTHHHHHHHHHHHHHHHTTcccccccccTTccccccccGGGGcccccccHHHHHHHHHTTTTTTcEEEEETTEEEEEEEEEcccTTccccccEEEETTTTEEEEEcTTccEEEEEEEEcTTccEEEGGGTTcHHTccTTcccTTTcHHHH DISOP:02AL 317-318| PSIPRED cEEEEEEcccHHHHHHHHHHHccccEEEEEEcccccccHHHHccccHHHHHHHHccccEEEccccccHHHHHHHHHccccEEEEccccccccHHHHHHccccEEEEcccccccccccHHHHHHHHccccEEEEEEEEEEcccccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccEEcccccccccccccHHHEEccccccHHHHHHHHHcccccccEEEEEccEEEEEEEEEEEccccccccccEEEEEcccEEEEEccccEEEEEEEEccccccccHHHHHcccccccHHcccccccccc //