[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50244.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:79 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 5->51 PSD11_MOUSE 7e-04 34.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50244.1 GT:GENE ABO50244.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1876440..1876679) GB:FROM 1876440 GB:TO 1876679 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO50244.1 GB:DB_XREF GI:134052273 LENGTH 79 SQ:AASEQ MTVDVDKFVQEHQEEIITLVNNSLNRAGDIVAKKVQSGELGATLQDVLPIMLYEILLTNTVSTLRLVSEMVNETEKNTN GT:EXON 1|1-79:0| BL:SWS:NREP 1 BL:SWS:REP 5->51|PSD11_MOUSE|7e-04|34.0|47/422| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,71-80| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //