[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50249.1
DDBJ      :             inner-membrane translocator
Swiss-Prot:             

Homologs  Archaea  11/68 : Bacteria  454/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
:300 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   17->241 PF02653 * BPD_transp_2 3e-23 39.3 %
:HMM:PFM   14->265 PF02653 * BPD_transp_2 1.6e-46 31.6 250/267  
:BLT:SWISS 14->273 BRAE_PSEAE 2e-35 35.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50249.1 GT:GENE ABO50249.1 GT:PRODUCT inner-membrane translocator GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1881712..1882614 GB:FROM 1881712 GB:TO 1882614 GB:DIRECTION + GB:PRODUCT inner-membrane translocator GB:NOTE PFAM: inner-membrane translocator KEGG: gsu:GSU3393 branched-chain amino acid ABC transporter, permease protein GB:PROTEIN_ID ABO50249.1 GB:DB_XREF GI:134052278 InterPro:IPR001851 LENGTH 300 SQ:AASEQ MDSIFSMFLNDYYIQVLTMLGIYLIGALGLNLITGVTGQLSFGHAAFLSIGAYTSAIFSVKLGMSFPVAIIAGGLMSGFWGILLGYPTLRLTGDYLGIATLGFGEIVRVVFLNLSITGGALGMAGIPRSSSLTVVILVVIVTVWAMVRLENSRFGRSLLAIREDEIAAEAMGVNITTSKITAFAIGTFIAGVSGGLYAHLLTYLNPSDFGFLKSFEFLTFVVLGGLGSIPGVILGTSILTLAPEFLRFIADYRMMVYGLLMVVMMIVRPRGLLGGVKVSRILNKKSLPKNKNTSATGGVN GT:EXON 1|1-300:0| BL:SWS:NREP 1 BL:SWS:REP 14->273|BRAE_PSEAE|2e-35|35.1|259/417| TM:NTM 8 TM:REGION 15->37| TM:REGION 42->64| TM:REGION 68->90| TM:REGION 100->122| TM:REGION 129->151| TM:REGION 181->203| TM:REGION 221->243| TM:REGION 247->268| SEG 130->143|ssltvvilvvivtv| SEG 254->267|mmvygllmvvmmiv| RP:PFM:NREP 1 RP:PFM:REP 17->241|PF02653|3e-23|39.3|224/271|BPD_transp_2| HM:PFM:NREP 1 HM:PFM:REP 14->265|PF02653|1.6e-46|31.6|250/267|BPD_transp_2| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF02653|IPR001851| GO:PFM GO:0006810|"GO:transport"|PF02653|IPR001851| GO:PFM GO:0016020|"GO:membrane"|PF02653|IPR001851| OP:NHOMO 1211 OP:NHOMOORG 468 OP:PATTERN 22-1------------2------24---7-33---------------1----------------2--- ---11---------1------2---3------122211--231111---111111--111118-1-2121121112112---2------------1-------------------------------------2--23342111232114112-122------2121122-------------6641111--------------------1--------3411--------41------------------------11-----11--11---11----1111---11111111111111-------------1111111111121-31111111-1---11----3-1--5--23221342-111---1111-1------1111-2HDF414EAAFB44244244235-12B21C2A351-7332157433229G1--5381222745111111115---1614-----------------------------2-----AIG7B54545612222559333332346E68751244252344B6A9EE334-1--12----------4761A72218248333622121122-12221122A1--1-111111----------11----112-211---1------1-----1--1-1--------------2121-2-1111111111-11111111111111111113331111-111111111111111131111111--1111111-1111---------------223---------------------2---2122222323222233232--------------------1-------------------2---------------1---------------------------213--14111-1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------------------1--3---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 278-301| PSIPRED ccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccccccccccccc //