[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50250.1
DDBJ      :             ABC transporter related
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  907/915 : Eukaryota  194/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:256 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   5->253 1g6hA PDBj 3e-40 34.8 %
:RPS:PDB   5->251 3b5jA PDBj 1e-40 23.5 %
:RPS:SCOP  1->252 1ji0A  c.37.1.12 * 8e-48 33.1 %
:HMM:SCOP  2->257 1g6hA_ c.37.1.12 * 1.8e-64 33.9 %
:RPS:PFM   45->182 PF00005 * ABC_tran 7e-11 32.5 %
:HMM:PFM   45->181 PF00005 * ABC_tran 1.8e-24 32.8 116/118  
:HMM:PFM   230->252 PF12399 * BCA_ABC_TP_C 8.6e-14 60.9 23/23  
:HMM:PFM   17->63 PF03193 * DUF258 3e-06 21.7 46/161  
:BLT:SWISS 1->253 BRAF_PSEAE 6e-65 46.2 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50250.1 GT:GENE ABO50250.1 GT:PRODUCT ABC transporter related GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1882628..1883398 GB:FROM 1882628 GB:TO 1883398 GB:DIRECTION + GB:PRODUCT ABC transporter related GB:NOTE PFAM: ABC transporter related SMART: AAA ATPase KEGG: gsu:GSU3392 branched-chain amino acid ABC transporter, ATP-binding protein GB:PROTEIN_ID ABO50250.1 GB:DB_XREF GI:134052279 InterPro:IPR003439 InterPro:IPR003593 LENGTH 256 SQ:AASEQ MSKVILELNSVTIRFGGLTAVDNVNMKIEQGTIRALIGPNGAGKSTIFNLITGIYPPSAGEISFLGARISDLKPHAITEMGIARTFQNIRLFDEMTVLDNVKIGQHCRTKTGFLGSIIRGPSVKAEEKAITEASMEALKLMELEHKADELAMNLPYGEQRRLEIARALATNPKLILLDEPAAGMNPQEKMTLVAMIRKIQSRGLTIFLVEHDMKFVMNLSDRIAVLDYGRKIAAGSPAEIQRDPAVIAAYLGKEVV GT:EXON 1|1-256:0| BL:SWS:NREP 1 BL:SWS:REP 1->253|BRAF_PSEAE|6e-65|46.2|253/255| COIL:NAA 28 COIL:NSEG 1 COIL:REGION 127->154| BL:PDB:NREP 1 BL:PDB:REP 5->253|1g6hA|3e-40|34.8|247/254| RP:PDB:NREP 1 RP:PDB:REP 5->251|3b5jA|1e-40|23.5|230/243| RP:PFM:NREP 1 RP:PFM:REP 45->182|PF00005|7e-11|32.5|123/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 45->181|PF00005|1.8e-24|32.8|116/118|ABC_tran| HM:PFM:REP 230->252|PF12399|8.6e-14|60.9|23/23|BCA_ABC_TP_C| HM:PFM:REP 17->63|PF03193|3e-06|21.7|46/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 1->252|1ji0A|8e-48|33.1|236/240|c.37.1.12| HM:SCP:REP 2->257|1g6hA_|1.8e-64|33.9|254/254|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 47253 OP:NHOMOORG 1169 OP:PATTERN RQHCOKIHRPQNPMROlIRPJSNasOShlShTICEDEAHGIGEVbPViNR**j9OaNPVLTHJFV19C UXiM*dWapprTUQXONML-LiAAX*MMMMMNmjkjr***U*Y*iznYqjaP*xuPQeBDrp*d*qx***dWWWWrbZbQ*gmB7C6CTSRN8NGLI11EHUMKJgLWJR6787677ACBAAAAHTNMQaOKSSYRnvvv*MLL*boioxceofhWXMELGNGggck***ZGMHLGGFPHKHGjacXWniAPew************************dlw**ilvuvsut**agggdgdceegggeecaWba*bbby*XRaVdyxOP**eZTZihbgfmlpvmmruyzpsoojlotlpodddcbdecfedcbxoneedsqtnm***********g*ir***cjkh*sets*grTM**qkbdfjQZiZopQYXbOdTQQLKJHIKeY***YTt****************-mu*le*j***QB**************GJJ**********NMNNNNNN*YdIRjW*665565556535769A7887787796575MD9BCF***********z***y********p********CP**u*lvou******ZnkKVKPhVIJIIKIIQKQYnkb**TeUwjXhsYWoJdaZQSYhVXVWXVqzX*IKOTGKKKMJF7C9A99A8AEPFGKLKnoxPvSdGUN*SUWXUPUdSPQVSTaVXYd6-EKSNL211---*z**a*x********zz-**z**y*******vwzxvx*****jjfooklmonnonllolll*upqvvuwQ3************54JHDFCDEMMOMPK*k*cccZXaINRLLUNSeMOPNOFSHOWpcsvrsv***v**xxj***HFEDEFFDFKhsq*rssss**z**QPPMOMLKMLFDDD88LUQPJKIH7A998898*FaB9B6A-9CBDFDBLLLBALBFDAABaisVVl*nkiEeO 12--dZD-ZF5DLULHCCB7GKDK9KEDD8B7AIGE9EBDBCD798CADIKFPKDDE7ABABA58254-5745566512455546435-AH5C789777677CHJA3FRbYQOMbZQGEC6EOIji6qA**f4gNhIFFAYAKWO9IEADVB9*ETQLpEa*HgHY8mRV*LVODD9B6*998BFiQP*BpmFE*m*tJ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccccEEEEEcEEEEEccEEEEcccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHcccccccccccccccccHHHHHHHHHHHcccccHHHHHHccccccccHHHHHHHHHHHHHHccccHHccccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEEcHHHHHccHHHHHHHcccccc //