[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50254.1
DDBJ      :             BFD domain protein (2Fe-2S)-binding domain protein
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  54/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:99 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->90 1y56A PDBj 4e-13 41.0 %
:HMM:PFM   11->54 PF04324 * Fer2_BFD 3.4e-11 42.1 38/54  
:BLT:SWISS 8->90 OOXA1_RHIME 4e-12 36.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50254.1 GT:GENE ABO50254.1 GT:PRODUCT BFD domain protein (2Fe-2S)-binding domain protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1888227..1888526 GB:FROM 1888227 GB:TO 1888526 GB:DIRECTION + GB:PRODUCT BFD domain protein (2Fe-2S)-binding domain protein GB:NOTE PFAM: BFD domain protein [2Fe-2S]-binding domain protein KEGG: tko:TK0121 proline dehydrogenase, delta subunit GB:PROTEIN_ID ABO50254.1 GB:DB_XREF GI:134052283 InterPro:IPR007419 LENGTH 99 SQ:AASEQ MSQKDENDVTILCRCEDITIEEVRSYIQRGITDLEQLKRLLRVGMGPCQGRTCTPLLVNELARATGQEIKRIHLTVFRQPTTPVKLGVLAGGTDHEENS GT:EXON 1|1-99:0| BL:SWS:NREP 1 BL:SWS:REP 8->90|OOXA1_RHIME|4e-12|36.1|83/458| BL:PDB:NREP 1 BL:PDB:REP 12->90|1y56A|4e-13|41.0|78/484| HM:PFM:NREP 1 HM:PFM:REP 11->54|PF04324|3.4e-11|42.1|38/54|Fer2_BFD| OP:NHOMO 83 OP:NHOMOORG 63 OP:PATTERN --1-1-------------------------------------------------2211111------- --------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------1---1------1----------------1-1------------------1---------1---1--21-1----12------1-----1-----------------------------------------------------11--122211-----2221-------211---------------5123------------------------2-2---1---------------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111---1-1----111--------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 84 STR:RPRED 84.8 SQ:SECSTR ###########cccc#cccHHHHHHHHHTTcccHHHHHHHccTTccTTTTTTTHHHHHHHHHHHHcccGGGccccccccccccccGGGGcTTccGG### DISOP:02AL 1-5,91-100| PSIPRED ccccccccccEEEEEHHccHHHHHHHHHcccccHHHHHHHccccccccccHHHHHHHHHHHHHHHcccHHHccccccccccccccHHHHHccccccccc //