[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50267.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:119 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   80->99 PF08897 * DUF1841 0.00074 35.0 20/137  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50267.1 GT:GENE ABO50267.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1903459..1903818) GB:FROM 1903459 GB:TO 1903818 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO50267.1 GB:DB_XREF GI:134052296 LENGTH 119 SQ:AASEQ MNDKVTKIRKALSLLENTLGQDLILKEVHKIGGWNPEAAPQLHPLVLLWYKTREEMGIAELTGIQPSSHRIYELLLISDLLQKICQHPEYHSLVTQLQNLDQYEAAIDRMKKIGNDFNQ GT:EXON 1|1-119:0| HM:PFM:NREP 1 HM:PFM:REP 80->99|PF08897|0.00074|35.0|20/137|DUF1841| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,115-120| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEccHHHccHHHHHccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //