[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50272.1
DDBJ      :             Radical SAM domain protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  49/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.1.28
:198 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   14->185 3cixA PDBj 3e-10 14.3 %
:RPS:SCOP  15->178 1tv7A  c.1.28.3 * 2e-11 24.1 %
:HMM:SCOP  14->185 1tv8A_ c.1.28.3 * 7e-16 27.2 %
:HMM:PFM   18->160 PF04055 * Radical_SAM 2.4e-13 25.0 136/166  
:BLT:SWISS 13->138 MOAA_META3 2e-07 35.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50272.1 GT:GENE ABO50272.1 GT:PRODUCT Radical SAM domain protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1909525..1910121 GB:FROM 1909525 GB:TO 1910121 GB:DIRECTION + GB:PRODUCT Radical SAM domain protein GB:NOTE PFAM: Radical SAM domain protein KEGG: chy:CHY_0937 radical SAM domain protein GB:PROTEIN_ID ABO50272.1 GB:DB_XREF GI:134052301 InterPro:IPR007197 LENGTH 198 SQ:AASEQ MDRQFIISYQIDETLYLNITNQCMNQCVFCIRETETGVGYNLWLNKEPTVEEVLDSVKNPQSYNEIVFCGYGEPLSRLEVVKGVASKLKEMGARSIRINTNGQANKYYGHNIIPELAGLIDTMSISLNAQNATVYTEICRPADGENAYFSMLEFARKCVGVIPRVILSVVEWPGVDIEACETIAQNLGTEFRLRKPTL GT:EXON 1|1-198:0| BL:SWS:NREP 1 BL:SWS:REP 13->138|MOAA_META3|2e-07|35.3|116/299| RP:PDB:NREP 1 RP:PDB:REP 14->185|3cixA|3e-10|14.3|161/345| HM:PFM:NREP 1 HM:PFM:REP 18->160|PF04055|2.4e-13|25.0|136/166|Radical_SAM| RP:SCP:NREP 1 RP:SCP:REP 15->178|1tv7A|2e-11|24.1|158/327|c.1.28.3| HM:SCP:REP 14->185|1tv8A_|7e-16|27.2|162/0|c.1.28.3|1/1|Radical SAM enzymes| OP:NHOMO 55 OP:NHOMOORG 54 OP:PATTERN -------------------------------------------------1111--------------- -----------------------------------------------------------------------------------11------------------------------------------------1------------------------------------------------------111------------------------------------------------------------------------------------------------------------------------------------1---------------1------------11--1--1----1----1----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111--1---------------------------------------11111-1111111111111---------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------1-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 178 STR:RPRED 89.9 SQ:SECSTR #############EEEEEEEcccccccTTcTTcTTccccccccccHHHHHHHHHHHHHTTTcccEEEEEEcccGGGTTHHHHHHHHHHHTTcccEEEEEccccHHHccHHHHHHHHHTTccEEEcccccccHHHHHHHcTTcccTccHHHHHHHHHHHHTTcEEEEccEEccTTccHHHHHHHHHGGGHHH####### DISOP:02AL 1-1,198-199| PSIPRED cccccccccccccEEEEEcccccccccccccccccccccccccccccccHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHcccccccHHHHHHHHHHHHHHcccEEEEEEEEEccccHHHHHHHHHHccHHHHHHcccc //