[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50279.1
DDBJ      :             6-pyruvoyl tetrahydropterin synthase and hypothetical protein
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  401/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.96.1
:128 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->127 2obaB PDBj 3e-14 38.3 %
:RPS:PDB   1->125 3d7jA PDBj 1e-33 26.0 %
:RPS:SCOP  10->127 1b66A  d.96.1.2 * 3e-28 27.7 %
:HMM:SCOP  1->127 1b66A_ d.96.1.2 * 2.3e-41 44.3 %
:RPS:PFM   4->124 PF01242 * PTPS 2e-24 45.8 %
:HMM:PFM   4->126 PF01242 * PTPS 1.9e-42 46.7 120/123  
:BLT:SWISS 6->125 PTPS_ARCFU 3e-15 39.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50279.1 GT:GENE ABO50279.1 GT:PRODUCT 6-pyruvoyl tetrahydropterin synthase and hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1918916..1919302 GB:FROM 1918916 GB:TO 1919302 GB:DIRECTION + GB:PRODUCT 6-pyruvoyl tetrahydropterin synthase and hypothetical protein GB:NOTE PFAM: 6-pyruvoyl tetrahydropterin synthase and hypothetical protein KEGG: tcx:Tcr_1389 6-pyruvoyl tetrahydropterin synthase and hypothetical protein GB:PROTEIN_ID ABO50279.1 GB:DB_XREF GI:134052308 InterPro:IPR007115 LENGTH 128 SQ:AASEQ MFELTVKNKFSAAHVLCGYPGDCARLHGHTWTVEVKVFGKELNELGMLIDFKDIKKQLATIINEFDHSYINDLPGFGEDGVNPTAENLSYYIFQTLAQRISSIQMGVKLKEVSVWESPDAYATYREDF GT:EXON 1|1-128:0| BL:SWS:NREP 1 BL:SWS:REP 6->125|PTPS_ARCFU|3e-15|39.6|106/115| BL:PDB:NREP 1 BL:PDB:REP 3->127|2obaB|3e-14|38.3|115/120| RP:PDB:NREP 1 RP:PDB:REP 1->125|3d7jA|1e-33|26.0|123/132| RP:PFM:NREP 1 RP:PFM:REP 4->124|PF01242|2e-24|45.8|118/123|PTPS| HM:PFM:NREP 1 HM:PFM:REP 4->126|PF01242|1.9e-42|46.7|120/123|PTPS| GO:PFM:NREP 3 GO:PFM GO:0003874|"GO:6-pyruvoyltetrahydropterin synthase activity"|PF01242|IPR007115| GO:PFM GO:0006729|"GO:tetrahydrobiopterin biosynthetic process"|PF01242|IPR007115| GO:PFM GO:0046872|"GO:metal ion binding"|PF01242|IPR007115| RP:SCP:NREP 1 RP:SCP:REP 10->127|1b66A|3e-28|27.7|112/138|d.96.1.2| HM:SCP:REP 1->127|1b66A_|2.3e-41|44.3|122/0|d.96.1.2|1/1|Tetrahydrobiopterin biosynthesis enzymes-like| OP:NHOMO 457 OP:NHOMOORG 417 OP:PATTERN -----------------------1----11--------------11111-121-1-111--------- 111---------------------1------1---------1211---------------------------------111-1112221111-1-----11111----1---------------------------222--1111--2212211111-11-1-11-1111--111---1-11-1----1111111111111111111111111111111111111------1111111111111111111111----------------------------------11---------------------------111----1--112222222-2-----1-----1---1-11--111---1-11111--111---------111---111111111111111111-1111111112-1-11111111111-------1-----11-----------------------------111------------------1-111-----------------------------------1---1----------------------1-----2111111121222111111111122222212---------------------------------1-----------------------1--1--11-----11111111111111111-111111111111111111111111111-111111111111111111111111-111111111111--1---------------111111111111--1----------1-1111111-1---11111---------1111-111-1111111111111111111111--222222------------------------------------11-1111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 127 STR:RPRED 99.2 SQ:SECSTR cEEEEEEEEEEEEccccGGGGGGGccEEEEEEEEEEEEEccccTTcccccHHHHHHHHHHHHHTTTTEEGGGcGGGTTTcccccHHHHHHHHHHHHHHHHHTTTTcGGGGEEEEEcccccEEEEEcc# PSIPRED cEEEEEEEEEEcccccccccccccccccccEEEEEEEEEEEcccccEEEEHHHHHHHHHHHHHHHcccEEcccHHHHHccccccHHHHHHHHHHHHHHHccccccccEEEEEEEEEccccEEEEEEcc //