[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50285.1
DDBJ      :             5'-nucleotidase / 3'-nucleotidase / exopolyphosphatase
Swiss-Prot:SURE_DESRM   RecName: Full=5'-nucleotidase surE;         EC=3.1.3.5;AltName: Full=Nucleoside 5'-monophosphate phosphohydrolase;

Homologs  Archaea  47/68 : Bacteria  576/915 : Eukaryota  44/199 : Viruses  0/175   --->[See Alignment]
c.106.1
:253 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->250 2v4oD PDBj 1e-51 47.9 %
:RPS:PDB   1->249 2e6cA PDBj 1e-76 40.8 %
:RPS:SCOP  2->246 1ilvA  c.106.1.1 * 5e-84 44.8 %
:HMM:SCOP  1->250 1l5xA_ c.106.1.1 * 1.3e-80 50.0 %
:RPS:PFM   1->184 PF01975 * SurE 5e-45 54.1 %
:HMM:PFM   1->187 PF01975 * SurE 1.2e-69 51.9 187/197  
:BLT:SWISS 1->253 SURE_DESRM e-150 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50285.1 GT:GENE ABO50285.1 GT:PRODUCT 5'-nucleotidase / 3'-nucleotidase / exopolyphosphatase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1922104..1922865 GB:FROM 1922104 GB:TO 1922865 GB:DIRECTION + GB:PRODUCT 5'-nucleotidase / 3'-nucleotidase / exopolyphosphatase GB:NOTE KEGG: chy:CHY_0957 acid phosphatase SurE TIGRFAM: stationary-phase survival protein SurE PFAM: Survival protein SurE GB:PROTEIN_ID ABO50285.1 GB:DB_XREF GI:134052314 InterPro:IPR002828 LENGTH 253 SQ:AASEQ MRILISNDDGIYADGIGQLRKAMETIASEVYVVAPDRERSACGHGITVTRPLRAKVHPFKSGHAKGWVIDGTPADCVKLGLESLLENPPDLVVSGINLGPNLGTDVLYSGTVSAAYEAIINHVPAIAVSLAAWEELNYQVAADFMKDFIPMLKEHPMGEGMLLNINIPNNYNGRGIKVTRLGRRRYIKCFDKRVDPRGKTYFWMAGEPQNLDDDDPETDAAAVNDGYVSVTPLHLDLTDYSYKKKLAGWLPTK GT:EXON 1|1-253:0| SW:ID SURE_DESRM SW:DE RecName: Full=5'-nucleotidase surE; EC=3.1.3.5;AltName: Full=Nucleoside 5'-monophosphate phosphohydrolase; SW:GN Name=surE; OrderedLocusNames=Dred_1760; SW:KW Complete proteome; Cytoplasm; Hydrolase; Metal-binding;Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->253|SURE_DESRM|e-150|100.0|253/253| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| BL:PDB:NREP 1 BL:PDB:REP 1->250|2v4oD|1e-51|47.9|242/258| RP:PDB:NREP 1 RP:PDB:REP 1->249|2e6cA|1e-76|40.8|238/243| RP:PFM:NREP 1 RP:PFM:REP 1->184|PF01975|5e-45|54.1|183/193|SurE| HM:PFM:NREP 1 HM:PFM:REP 1->187|PF01975|1.2e-69|51.9|187/197|SurE| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF01975|IPR002828| RP:SCP:NREP 1 RP:SCP:REP 2->246|1ilvA|5e-84|44.8|241/246|c.106.1.1| HM:SCP:REP 1->250|1l5xA_|1.3e-80|50.0|244/276|c.106.1.1|1/1|SurE-like| OP:NHOMO 740 OP:NHOMOORG 667 OP:PATTERN 11---1----------21221221111121211111111111111111111111---11111--1--- ---------------------1---1---------------1---1---------1--------1-----------------11-11111111111---1111112121211111111211111111111111111222--1111-22222212211111111221122231111111111111112311-1---------------------------------------1--------------------------------------------------------------------------------------------1--11111111111--11-----1---1--111111111111111-1--1121111-----111111111111111111111111-111111111111111111111111111111111111111---------1---1211111111111---------------1111-1-111111112222221111122221111112112122-1111111111111111111111111111111111111-1-1-111111112111111111111111111111111111111111111111111111111-1-111111111111111111111111--11111------11--1111111111111-1111111111111111111111--21111111111111111111111111111111111111111---11111111111-1111111111111111111111111-1-1-11111112111111111---------11111111111111111111111111111111-111111---------11-------------------------1111111111-1- -----------1---11--1---13-1------11--------11---112221--------------1--13-----------21---1111111-------1-----------------------------------------------------------------------11213---1-2234131--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 250 STR:RPRED 98.8 SQ:SECSTR cEEEEEccccTTcHHHHHHHHHHTTTccEEEEEEEcccccccccccccccccEEEEccTTcccccEEEEEccHHHHHHHHHHHHHcccccEEEEEEEEccccGGGGGGcHHHHHHHHHHHTTcEEEEEEEcccccccccHHHHHHHHHHHHTTTcccccccEEEEEccccccccEEEEcccccccEEccEEEEEcTTccEEEEEccEEcccccccTTcHHHHHHTTEEEEEEcccccccTTccccccccH### DISOP:02AL 213-213,252-254| PSIPRED cEEEEEcccccccHHHHHHHHHHHHcccEEEEEccccccccccccccccccEEEEEEEcccccccEEEEccccHHHHHHHHHHHccccccEEEEcccccccccccHHccHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccccEEEEEcccccccccccEEEcccccEEEEEccccccccccccccHHHHHHcccEEEEEcccccccHHHHHHHHHHHccc //