[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50289.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:73 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   28->68 PF00166 * Cpn10 0.00086 19.5 41/93  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50289.1 GT:GENE ABO50289.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1930722..1930943 GB:FROM 1930722 GB:TO 1930943 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO50289.1 GB:DB_XREF GI:134052318 LENGTH 73 SQ:AASEQ MPTLTGITIDEYGQLRFPLEVSQILNLKNNEMLKVKIQSDHLVLIPQKAGTDEEILDEMLKVIIHEGILIDIK GT:EXON 1|1-73:0| HM:PFM:NREP 1 HM:PFM:REP 28->68|PF00166|0.00086|19.5|41/93|Cpn10| OP:NHOMO 3 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------21--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccEEEEEEHHcccEEEEEEHHHHcccccccEEEEEEcccEEEEEEccccccHHHHHHHHHHHHHccEEEEEc //