[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50303.1
DDBJ      :             electron transfer flavoprotein beta-subunit
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  539/915 : Eukaryota  164/199 : Viruses  0/175   --->[See Alignment]
c.26.2
:255 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->230 1efpB PDBj 2e-29 35.7 %
:RPS:PDB   1->254 2a1uB PDBj 6e-46 35.4 %
:RPS:SCOP  1->242 1efpB  c.26.2.3 * 2e-41 34.7 %
:HMM:SCOP  1->250 1efvB_ c.26.2.3 * 1.1e-74 44.3 %
:RPS:PFM   33->180 PF01012 * ETF 5e-15 40.7 %
:HMM:PFM   31->181 PF01012 * ETF 3.6e-41 37.2 148/164  
:BLT:SWISS 1->255 ETFB_BACSU 7e-49 41.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50303.1 GT:GENE ABO50303.1 GT:PRODUCT electron transfer flavoprotein beta-subunit GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1948296..1949063 GB:FROM 1948296 GB:TO 1949063 GB:DIRECTION + GB:PRODUCT electron transfer flavoprotein beta-subunit GB:NOTE PFAM: electron transfer flavoprotein beta-subunit KEGG: chy:CHY_1352 electron transfer flavoprotein, beta subunit GB:PROTEIN_ID ABO50303.1 GB:DB_XREF GI:134052332 InterPro:IPR000049 LENGTH 255 SQ:AASEQ MKILVLLKQVFDTEAVIKIADGKISGDGITQIINPYDEFAVEEALKIAEATKGEVTIVSVGADVEQTVRQALAMGATNGYVVEDAAMTDVDEYSIATILSKAIGAMQYDLILAGWRAIDDGSAQVASRVAQALNIPLVNLAIKLDVADGKATAVTEIDGGTATIEVPLPAVVTCQKGLNEPRYPSMKGIMQAKKKKIEKVGLGALGLDASAVAAKAKTLNIYLPQTRAAGKVITDEPAVAAKEVAKLLREEAKVI GT:EXON 1|1-255:0| BL:SWS:NREP 1 BL:SWS:REP 1->255|ETFB_BACSU|7e-49|41.2|255/257| BL:PDB:NREP 1 BL:PDB:REP 1->230|1efpB|2e-29|35.7|227/246| RP:PDB:NREP 1 RP:PDB:REP 1->254|2a1uB|6e-46|35.4|246/252| RP:PFM:NREP 1 RP:PFM:REP 33->180|PF01012|5e-15|40.7|145/157|ETF| HM:PFM:NREP 1 HM:PFM:REP 31->181|PF01012|3.6e-41|37.2|148/164|ETF| RP:SCP:NREP 1 RP:SCP:REP 1->242|1efpB|2e-41|34.7|239/246|c.26.2.3| HM:SCP:REP 1->250|1efvB_|1.1e-74|44.3|246/0|c.26.2.3|1/1|Adenine nucleotide alpha hydrolases-like| OP:NHOMO 1087 OP:NHOMOORG 733 OP:PATTERN 22----2222222222-22322211111-111-----------------------------2322--- 12322-1111111111111-11111111111111111122111111-11---111112--112-1111121--------121------11111122---111111111-1---------------1111111112111122---12-------11-----------1----------------11111--11211111111111111111111111111131111------21----------------------1-------------------------------------------------------------------1532444444443431422422214-1-1-12-973463-141--11-2-12-11111111132222111222221111111111111121131112113112334335232311111111111112222222212211322-----------------------------1121112311211122111111113611111134511121112161222231212111-1121111111-1---14115421----------7471926--11211114-------------------------1111-1111121-1111111311112132121-----1-------1-1-1--2222222221-2222222222222222221-------13221333332313113--112221-----------------1111111111-1113---------------11111111114111111111111111112-------------1-----11-1111111111111111--11111111----------1-------------------------11111121111-- ----111-211-111-11111111111111111111111111111111111111-1111111111111-11111111111111111-1-12111111111111112-1-12111-21-1--11-11-3-282-112-11-11111--1111--1--1111111111121121111111-----111112-111121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 254 STR:RPRED 99.6 SQ:SECSTR cEEEEEccEEEcTTccccccccccccTTccEEEcHHHHHHHHHHHHHHHTTccEEEEEEEEcTHHHHHHHHHHHTccEEEEEEccHHHHccHHHHHHHHHHHHHHTTccEEEEEcccTTTccccHHHHHHHHHTccEEEEEEEEEEcccEEEEEEEETTEEEEEEEEccEEEEEcTTccccccccHHHHHHHTTccEEEEcGGGGTcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHTTcc# DISOP:02AL 222-231| PSIPRED cEEEEEEEEcccccEEEEcccccEEEccccccccHHcHHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHcccEEEEEEEEEEEccEEEEEEEccccEEEEEEcccEEEEEEccccccccccHHHHHHHcccEEEEEcHHHccccHHHccccccEEEEEEcccccccEEEcccHHHHHHHHHHHHHHHcccc //