[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50304.1
DDBJ      :             electron transfer flavoprotein, alpha subunit
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  544/915 : Eukaryota  175/199 : Viruses  0/175   --->[See Alignment]
c.26.2c.31.1
:325 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->320 1o97D PDBj 7e-43 31.7 %
:RPS:PDB   5->320 3clsD PDBj 2e-45 31.1 %
:RPS:SCOP  2->217 1efpB  c.26.2.3 * 6e-29 16.5 %
:RPS:SCOP  197->320 1efpA2  c.31.1.2 * 6e-54 65.3 %
:HMM:SCOP  3->195 1o97D1 c.26.2.3 * 3.2e-53 35.4 %
:HMM:SCOP  199->320 1o97D2 c.31.1.2 * 2.9e-51 66.4 %
:RPS:PFM   8->160 PF01012 * ETF 2e-17 34.2 %
:RPS:PFM   199->284 PF00766 * ETF_alpha 6e-29 69.8 %
:HMM:PFM   4->162 PF01012 * ETF 1.4e-48 37.6 157/164  
:HMM:PFM   200->284 PF00766 * ETF_alpha 6.8e-40 64.7 85/86  
:BLT:SWISS 1->323 ETFA_BACSU 4e-80 47.5 %
:PROS 264->290|PS00696|ETF_ALPHA
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50304.1 GT:GENE ABO50304.1 GT:PRODUCT electron transfer flavoprotein, alpha subunit GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1949078..1950055 GB:FROM 1949078 GB:TO 1950055 GB:DIRECTION + GB:PRODUCT electron transfer flavoprotein, alpha subunit GB:NOTE PFAM: electron transfer flavoprotein beta-subunit; electron transfer flavoprotein, alpha subunit KEGG: dsy:DSY3371 hypothetical protein GB:PROTEIN_ID ABO50304.1 GB:DB_XREF GI:134052333 InterPro:IPR000049 InterPro:IPR001308 LENGTH 325 SQ:AASEQ MAKGIWVFAEQRDGKIKKVTYELLSAGRGLADNLGEELCAVLFGKDVAGAAAALGEYGADKVFVADNEKLAEYTNDAYVNTLFDLAKANEPNAILFGYTASGRDLGASIAQRLETGMFSDCVSVKVDGGQLVFDRPLYAGKAFVSASCPEARPVVAAMRPNVLAINEPQAGKQAEVVNVEVSGDIRQVIKEVAMAISSRPELTEASIIVSAGRGVKAPENMKLIEEFADSIGAAVGCSRAVVDAGWYPQAQQVGQTGKTVAANLYIACGISGAIQHLAGMSSSKCIVAINKDPEANIFKVADYGIVGDLFEVVPILKEELKKLLA GT:EXON 1|1-325:0| BL:SWS:NREP 1 BL:SWS:REP 1->323|ETFA_BACSU|4e-80|47.5|320/325| PROS 264->290|PS00696|ETF_ALPHA|PDOC00583| SEG 48->59|agaaaalgeyga| BL:PDB:NREP 1 BL:PDB:REP 5->320|1o97D|7e-43|31.7|312/315| RP:PDB:NREP 1 RP:PDB:REP 5->320|3clsD|2e-45|31.1|315/318| RP:PFM:NREP 2 RP:PFM:REP 8->160|PF01012|2e-17|34.2|149/157|ETF| RP:PFM:REP 199->284|PF00766|6e-29|69.8|86/86|ETF_alpha| HM:PFM:NREP 2 HM:PFM:REP 4->162|PF01012|1.4e-48|37.6|157/164|ETF| HM:PFM:REP 200->284|PF00766|6.8e-40|64.7|85/86|ETF_alpha| RP:SCP:NREP 2 RP:SCP:REP 2->217|1efpB|6e-29|16.5|212/246|c.26.2.3| RP:SCP:REP 197->320|1efpA2|6e-54|65.3|124/124|c.31.1.2| HM:SCP:REP 3->195|1o97D1|3.2e-53|35.4|192/0|c.26.2.3|1/1|Adenine nucleotide alpha hydrolases-like| HM:SCP:REP 199->320|1o97D2|2.9e-51|66.4|122/0|c.31.1.2|2/2|DHS-like NAD/FAD-binding domain| OP:NHOMO 1218 OP:NHOMOORG 749 OP:PATTERN 22----2222222222-22322212112-111-----------------------------3322--- 1232211111111111111-11111111111111111122111111-11---111112--11211111121--------152------11111122---111111111-1---------------1111111112111122---12-------11-----------1----------------11111--112111111-1111111111111111111131111------21----------------------1--------11---------------------------------------------------------1532555555554541433422215-3-1-12-973463-141--11-3-12-11111111132222111222221111111111112222242212113112334335233411111111111112222222222212322-----------------------------1121113321222233422222223722221245612121112261222231213111-112111111111---14115422----------7471915--11211114-------------------------1111-1112121-1111111311112132121-----1-------1-1-1--3222333332-2333333333233333331-------13231333332313113-2213222-----------------1111111111-1124---------------11111111114122222222222221223-------------1-----11-1111111111111111--12111111----------1-------------------------11111121111-- ----111-211-11111111111111111111111111111111111-111111111-1111111111--1111111111111111-1-12111111111111112-1212121111111111111-2-241-122111-1-1111111111-2122111211211121131111111-----1111321111121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 324 STR:RPRED 99.7 SQ:SECSTR #TccEEEEccEETTEEcTHHHHHHHHHHHHcccTTcEEEEEEEcTTGGGGHHHHccTTccEEEEEEccccccccHHHHHHHHHHHHHHHcccEEEEEccHHHHTTHHHHHHHcccEEEEEEcEEEEETTEEEEEEEETTTTEEEEEccTTcccEEEEEcTTcccccccccccEEEEEEcccccccccccccccccccccccTTcccEEEEEcGGGccGGGHHHHHHHHHHHTcEEEEcHHHHHTTcccGGGcccccccccTccEEEEEcccccHHHHHHHTTccEEEEEcccTTcGGGGTccEEEcccHHHHHHHHHHHcccHHc DISOP:02AL 164-178,325-326| PSIPRED ccccEEEEEEccccEEcHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHccccEEEEEEcHHHccccHHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHcccEEEEEEEEEEcccEEEEEEEEEcccEEEEEEEccccEEEEEEccccccccccccccccEEEEcccccccEEEEEEEEEccccccccccccEEEEEcccccccccHHHHHHHHHHHccEEEEcHHHHHcccccHHHEEcccccEEccEEEEEEEEcccHHHHHccccccEEEEEEccccccHHccccEEEEccHHHHHHHHHHHHHHHHc //