[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50308.1
DDBJ      :             protein of unknown function DUF224, cysteine-rich region domain protein
Swiss-Prot:             

Homologs  Archaea  56/68 : Bacteria  336/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.1.2d.174.1d.349.1
:386 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   26->159 1d0cB PDBj 1e-10 12.4 %
:RPS:SCOP  26->159 1d0cA  d.174.1.1 * 6e-10 13.2 %
:RPS:SCOP  283->351 2jovA1  d.349.1.1 * 2e-10 10.8 %
:HMM:SCOP  22->104 1nekB1 a.1.2.1 * 9.7e-17 26.5 %
:RPS:PFM   299->356 PF02754 * CCG 3e-05 34.5 %
:HMM:PFM   173->233 PF02754 * CCG 1.8e-16 36.1 61/64  
:HMM:PFM   297->359 PF02754 * CCG 9.6e-16 35.0 60/64  
:HMM:PFM   24->39 PF00037 * Fer4 6e-05 43.8 16/24  
:HMM:PFM   71->86 PF00037 * Fer4 0.00016 50.0 16/24  
:HMM:PFM   148->191 PF04906 * Tweety 0.00037 31.8 44/406  
:BLT:SWISS 22->86 FER_ENTHI 2e-06 50.0 %
:BLT:SWISS 65->385 FADF_BACSU 3e-74 39.6 %
:PROS 26->37|PS00198|4FE4S_FER_1
:PROS 72->83|PS00198|4FE4S_FER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50308.1 GT:GENE ABO50308.1 GT:PRODUCT protein of unknown function DUF224, cysteine-rich region domain protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1953785..1954945 GB:FROM 1953785 GB:TO 1954945 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF224, cysteine-rich region domain protein GB:NOTE PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain protein; protein of unknown function DUF224, cysteine-rich region domain protein KEGG: sfu:Sfum_1051 protein of unknown function DUF224, cysteine-rich region domain protein GB:PROTEIN_ID ABO50308.1 GB:DB_XREF GI:134052337 InterPro:IPR001450 InterPro:IPR004017 LENGTH 386 SQ:AASEQ MSEAATYFLEVRDAIVEMGGENINLCMQCGTCAGTCPWGRLEEKSPFNIRKMIYQGRMGLEGYETDDILYACTTCGHCVTRCPRGVKITDVVRAMRSVIGETGGIPKNLKAAVGSINSQGNPWSQPREKRDTWAKDLDINKFTPETEYLLFVCCTSAFDGRSQKIARSIAELLKKAGVSFGIIGNQEQCCGESIRKIGAESEFSMLAESNIKLFKENGVKKIITTSPHCLSAFKNDYPEFGGEFEVFHYTQILDDLVKEGKLSFTNAKNQKVIYHEPCYLGRHSQIFEAPRELLSQVPGVETIEFAKSQKDSLCCGGGGARIWMETESGQRFSDFKVQEASDKEADILVTACPYCVVMMEDSAKTLNKDEEIKIMDISEILKENLG GT:EXON 1|1-386:0| BL:SWS:NREP 2 BL:SWS:REP 22->86|FER_ENTHI|2e-06|50.0|48/59| BL:SWS:REP 65->385|FADF_BACSU|3e-74|39.6|321/705| PROS 26->37|PS00198|4FE4S_FER_1|PDOC00176| PROS 72->83|PS00198|4FE4S_FER_1|PDOC00176| RP:PDB:NREP 1 RP:PDB:REP 26->159|1d0cB|1e-10|12.4|121/414| RP:PFM:NREP 1 RP:PFM:REP 299->356|PF02754|3e-05|34.5|55/63|CCG| HM:PFM:NREP 5 HM:PFM:REP 173->233|PF02754|1.8e-16|36.1|61/64|CCG| HM:PFM:REP 297->359|PF02754|9.6e-16|35.0|60/64|CCG| HM:PFM:REP 24->39|PF00037|6e-05|43.8|16/24|Fer4| HM:PFM:REP 71->86|PF00037|0.00016|50.0|16/24|Fer4| HM:PFM:REP 148->191|PF04906|0.00037|31.8|44/406|Tweety| RP:SCP:NREP 2 RP:SCP:REP 26->159|1d0cA|6e-10|13.2|121/416|d.174.1.1| RP:SCP:REP 283->351|2jovA1|2e-10|10.8|65/77|d.349.1.1| HM:SCP:REP 22->104|1nekB1|9.7e-17|26.5|83/0|a.1.2.1|1/1|alpha-helical ferredoxin| OP:NHOMO 737 OP:NHOMOORG 393 OP:PATTERN 22-1-12111111112123223371111--113332223333323222365542---1--13334--- 1144211----1-111111-111111111111111111111111---1------------111-1221111---------11132111-----------112122121-4---------------11--1-11-2-33344---13-12111-------------------------------22211---1334444423434342343333223333422312------22--------------------1-----------------1----1-1-------------------------------------------------1111111-1------112-----2--22A93642--75-----1-15-----------------------------------11-11111-------1--------11---------------------1---1--------------------------------1----------1111111111111121111-1111-112--112----------1---2--1---------11-----B665352326332-A8B2A4813112112682---1---------111-1111---21------1---1-------------------------1-------------1111111111-111111111111111-11---------11-1111111111111--1-1112-----------------------------1111111-1-----111-------------11111111111111111-------------111111---11------------------111111-----------------------------------------------1- -------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 238 STR:RPRED 61.7 SQ:SECSTR #######################TTccHHHHHHHHHHHHHTcTTcTTGGGTTccEEEEcccccHHHHHHHHHHHHHHHHHHGGGccccEEEEccccTTccccEEcccccccccEEEcccccEEEcGGGHH##EEEcccHHHHHHHHHHTTcccccccccEccccHHHHHHHHTTTccEEEccTTcccHHHHHHHTcTTccEEEEEccccTTHHHHHHHHHcEEcc#######ccccccTTcccHH##HHHHHHGGGTTcTTcEEEEEccGGG################################################################################################################## DISOP:02AL 1-1| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccEEccccccccHHHHHHHHHHHcccccHHHHHHHHHccccHHHHccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHccccccccccccccEEEEcccccccccccHHHHHHHHHHHHHcccEEEEcccccccccHHHHHcccHHHHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHHccccEEHHHHHHHHHHHHcccccccccccEEEEEccHHHHHHccccHHHHHHHHHccccEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccEEEEccHHHHHHHHHHHHHccccccccEEEHHHHHHHHcc //