[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50317.1
DDBJ      :             small acid-soluble spore protein (minor)
Swiss-Prot:TLP_DESRM    RecName: Full=Protein tlp homolog;

Homologs  Archaea  0/68 : Bacteria  41/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:71 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->70 PF05823 * Gp-FAR-1 0.00014 23.8 63/154  
:BLT:SWISS 1->71 TLP_DESRM 3e-37 100.0 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50317.1 GT:GENE ABO50317.1 GT:PRODUCT small acid-soluble spore protein (minor) GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1963920..1964135) GB:FROM 1963920 GB:TO 1964135 GB:DIRECTION - GB:PRODUCT small acid-soluble spore protein (minor) GB:NOTE KEGG: bsu:BG11806 small acid-soluble spore protein (minor) GB:PROTEIN_ID ABO50317.1 GB:DB_XREF GI:134052346 LENGTH 71 SQ:AASEQ MAKPDNRNDNVEKLQEMVQDTIENLEEAHETLQNNSLSRDQRQAIMEKNKRREESIRSFRNEIKDEYQDLH GT:EXON 1|1-71:0| SW:ID TLP_DESRM SW:DE RecName: Full=Protein tlp homolog; SW:GN Name=tlp; OrderedLocusNames=Dred_1792; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->71|TLP_DESRM|3e-37|100.0|71/71| COIL:NAA 16 COIL:NSEG 1 COIL:REGION 21->36| HM:PFM:NREP 1 HM:PFM:REP 8->70|PF05823|0.00014|23.8|63/154|Gp-FAR-1| OP:NHOMO 41 OP:NHOMOORG 41 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11111111111111-1-1111111-1------------1----------------------------------------------------------------------------------------------111111111-1-1-------------------11------111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9,34-60,65-72| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //