[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50330.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:108 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->53 PF08806 * Sep15_SelM 0.00013 22.0 50/77  
:HMM:PFM   35->106 PF04079 * DUF387 0.00018 19.4 72/159  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50330.1 GT:GENE ABO50330.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1980168..1980494) GB:FROM 1980168 GB:TO 1980494 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO50330.1 GB:DB_XREF GI:134052359 LENGTH 108 SQ:AASEQ MDEKEQLYVNLMMDHLPEDCEVIALKKQGYLTENMQFTQKAHQYVEDFLASKKEAVFLAIIELGPEARKSSIMKYAGIKQMGVLADVVNRLVVEGKVKKENGKFYILA GT:EXON 1|1-108:0| SEG 92->103|vvegkvkkengk| HM:PFM:NREP 2 HM:PFM:REP 3->53|PF08806|0.00013|22.0|50/77|Sep15_SelM| HM:PFM:REP 35->106|PF04079|0.00018|19.4|72/159|DUF387| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccHHHHHHHHHHHcHHHHHHHHHHHHHHHHccEEEccccEEEEEc //