[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50352.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:243 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 63->176 KTHY_ASFM2 5e-04 24.8 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50352.1 GT:GENE ABO50352.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2007189..2007920) GB:FROM 2007189 GB:TO 2007920 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO50352.1 GB:DB_XREF GI:134052381 LENGTH 243 SQ:AASEQ MSEHKYTSIDELIKKSLKERAQKETDVDMDLAWEKFNNKYNSKPKFTSKWTGIACSLVFLLVAGLCFLPKEGTALNLKFLETIKSFVAGKVQTAQISFSTQEKEKDLENSLKPEVAQALKEVPYEVLLPADLTGQYNLEKAMTQKVGDSTKVMLFLKTTNSELVNISEINIIGDFNQATSYDTEDAVLEKVNVKGQNANLLTFKDGKKQLCWVDRDVFVTITGPLNQENLFILATSLRRVNLQ GT:EXON 1|1-243:0| BL:SWS:NREP 1 BL:SWS:REP 63->176|KTHY_ASFM2|5e-04|24.8|113/100| TM:NTM 1 TM:REGION 50->70| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,8-8,17-24,98-110,243-244| PSIPRED ccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHHcccEEEEEEEEccHHHHHHHHHcccHHHHHHHHHccEEEEEcccccccccHHHHHHHHHcccEEEEEEEEEccccEEEEHHEEEEEccccccccccHHHHHHHHccccccccEEEEccccEEEEEEEEEEEEEEEcccccccEEEEEEEEEEEccc //