[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50356.1
DDBJ      :             4Fe-4S ferredoxin, iron-sulfur binding domain protein
Swiss-Prot:             

Homologs  Archaea  55/68 : Bacteria  493/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:159 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->148 1kqfB PDBj 3e-15 34.3 %
:RPS:PDB   47->134 1a6lA PDBj 1e-07 19.8 %
:RPS:SCOP  11->158 1ti2B2  d.58.1.5 * 1e-21 27.1 %
:HMM:SCOP  1->149 1q16B_ d.58.1.5 * 1.5e-39 37.6 %
:HMM:PFM   7->22 PF00037 * Fer4 9.4e-07 43.8 16/24  
:HMM:PFM   61->71 PF00037 * Fer4 0.0004 54.5 11/24  
:HMM:PFM   81->99 PF00037 * Fer4 1.1e-08 42.1 19/24  
:BLT:SWISS 1->131 YSAA_ECOLI 4e-24 40.9 %
:PROS 86->97|PS00198|4FE4S_FER_1
:REPEAT 3|51->72|84->103|114->133

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50356.1 GT:GENE ABO50356.1 GT:PRODUCT 4Fe-4S ferredoxin, iron-sulfur binding domain protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 2011637..2012116 GB:FROM 2011637 GB:TO 2012116 GB:DIRECTION + GB:PRODUCT 4Fe-4S ferredoxin, iron-sulfur binding domain protein GB:NOTE PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain protein KEGG: swo:Swol_1832 Fe-S-cluster-containing hydrogenase components 2 GB:PROTEIN_ID ABO50356.1 GB:DB_XREF GI:134052385 InterPro:IPR000813 InterPro:IPR001450 LENGTH 159 SQ:AASEQ MGKVLLVNHLRCVGCGTCEVVCSLVHEGICSPVLSRIRIVRHEKKGYHIPITCASCEKAPCIEACPMEAIQKDKETGGVILHQDQCIGCKQCIQSCPFGHINFNFEKGTAFKCDLCQGDPQCVKFCWTQAISFTSLDAAIDAKRQTFADRIMKELKQET GT:EXON 1|1-159:0| BL:SWS:NREP 1 BL:SWS:REP 1->131|YSAA_ECOLI|4e-24|40.9|127/157| PROS 86->97|PS00198|4FE4S_FER_1|PDOC00176| NREPEAT 1 REPEAT 3|51->72|84->103|114->133| BL:PDB:NREP 1 BL:PDB:REP 6->148|1kqfB|3e-15|34.3|143/289| RP:PDB:NREP 1 RP:PDB:REP 47->134|1a6lA|1e-07|19.8|86/106| HM:PFM:NREP 3 HM:PFM:REP 7->22|PF00037|9.4e-07|43.8|16/24|Fer4| HM:PFM:REP 61->71|PF00037|0.0004|54.5|11/24|Fer4| HM:PFM:REP 81->99|PF00037|1.1e-08|42.1|19/24|Fer4| RP:SCP:NREP 1 RP:SCP:REP 11->158|1ti2B2|1e-21|27.1|144/195|d.58.1.5| HM:SCP:REP 1->149|1q16B_|1.5e-39|37.6|149/509|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 2371 OP:NHOMOORG 551 OP:PATTERN 22121221344333325-4354463113-1122-433333333-1--23-21222115262---4--- -5811-11111--1-1111-11--1211111-12221-111---112-1-----1-----2122112-31---------6bR334222-------------------------------------2243232232344411333-3----------------------------------------111----1111111-111111111-11-1111--2---1------1-1111111111111111111--------1---11-1-------------------------------------------------------134-21111111-1-1311-111--1--8--12li2244-5AB11131---521--1------21--323-32--11111111112-1131121311------------1121-11212-1--312111111113----6-4-------------------------------111-122-3211212233333323444413222324211232241443324212122-1-23----------A33-5B355A64754481AA868682-6595-34427422112211-1-------29232--74-111-----46997-5F9A9787BA8K8---1631------C5D9AA-HIIGHGFFHH-HHGIHGGHGHIGHFHHHHAAAA9621CHEGGHHHHHHGFHFGG6ACBFEFG--455555555555---1---------1112-444444133232114-------1-12-22221-1--11114-------------2333111114422322------------122--------------------------------------------21--1111112- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------3---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 146 STR:RPRED 91.8 SQ:SECSTR ##EEEEEEGGGGGccccccTccccTTTTcccTTcccccccccccccEEEcGGGTTTcccHHHHHcTTccEEEccccccEEEcTTTcccccccTTTcTTccEEEGGGccGGGTHHHHTTcccccccccccTTHHHEEcccccTTccccH########### DISOP:02AL 156-160| PSIPRED cccEEEEEccccccccHHHHHHHHHHcccccccEEEEEEEEccccEEEEEccccccccHHHHHHccccccEEcccccEEEEcHHHHccccEEHHccccccEEEEccccEEEEccccccccccHHHcccccEEEEEHHHHHHHHHHHHHHHHHHHHcccc //