[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50369.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:182 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->68 PF05652 * DcpS 0.00073 23.7 59/105  
:BLT:SWISS 12->169 Y1542_METJA 9e-04 33.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50369.1 GT:GENE ABO50369.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2023970..2024518) GB:FROM 2023970 GB:TO 2024518 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: gsu:GSU1552 hypothetical protein GB:PROTEIN_ID ABO50369.1 GB:DB_XREF GI:134052398 LENGTH 182 SQ:AASEQ MISNNLFELQKILSNNGLLISFSGRFSQSIIEELGEAVKKYLETEDRPKNDVYNVFSIFIEQTQNIKNYCEIKKESPHYERIANSCMVTIGKTETGNYICSGNIVEQKDAVVLTGIIDELIPLDKVALKKLYKEKLRQDISPDSLGAGIGLVDIARKASLPLEYSITTIDDNFLFFTLKAVV GT:EXON 1|1-182:0| BL:SWS:NREP 1 BL:SWS:REP 12->169|Y1542_METJA|9e-04|33.8|148/100| HM:PFM:NREP 1 HM:PFM:REP 10->68|PF05652|0.00073|23.7|59/105|DcpS| OP:NHOMO 39 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11----------------------------------------------------1----1--------------------------------------------1-------------------------------------1------------------1------------1-------1--1-----1-------1----------1-------1-1-1--------1-1---------------------------------1------1-------------------------------1----------11------------------------------------11--------------------------------------------------------------------------------------1111---------1-----------------------------------------------2222------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,133-148| PSIPRED cccHHHHHHHHHHHHccEEEEEEcHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEcccccEEEEEccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccccHHHHHHHHHccccEEEEEEEcccccEEEEEEEEc //