[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50374.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  103/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:359 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   207->320 1b6bA PDBj 2e-07 18.9 %
:RPS:SCOP  207->320 1b6bA  d.108.1.1 * 7e-08 18.9 %
:HMM:SCOP  1->357 1p0hA_ d.108.1.1 * 1.1e-29 23.6 %
:HMM:PFM   251->332 PF00583 * Acetyltransf_1 1.2e-07 24.6 69/83  
:BLT:SWISS 16->359 YGHO_ECOLI 3e-33 30.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50374.1 GT:GENE ABO50374.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2030133..2031212) GB:FROM 2030133 GB:TO 2031212 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: mxa:MXAN_3747 hypothetical protein GB:PROTEIN_ID ABO50374.1 GB:DB_XREF GI:134052403 InterPro:IPR000182 LENGTH 359 SQ:AASEQ MLKIIKVKEPGHWQKFLELPWLIYRKDPLWTPWADHGRMFDPQSNPILRHVRYECFLALDNDKPVGRIAAITDDLLADKRVGLFGCFESIDSSEVAGELIKAASQSLSDRGKNIIQGPATLNTSQQVGFLVEGFEKPPLFMMPYNPPYYIRLMEENGFYSILGLYSYSYSYSTKIDAKLASVAKRAARIPNIRIRPVNLNNPWREGEKLAAIHNETMTNQWGFVPMDQEEAASFIAGLRGNTDPELLIFCEVDNKPVGVCLMMPDAGPRIRAARRSGFNLPFTRSKLLRVGVLGVSPEYRRRGVVALLIDRARRTMLRKGYQQAELSLIMDTNKDMNRIITSAVGGQVSKRYRVYQKDL GT:EXON 1|1-359:0| BL:SWS:NREP 1 BL:SWS:REP 16->359|YGHO_ECOLI|3e-33|30.7|339/100| SEG 165->172|ysysysys| SEG 183->202|akraaripnirirpvnlnnp| RP:PDB:NREP 1 RP:PDB:REP 207->320|1b6bA|2e-07|18.9|106/168| HM:PFM:NREP 1 HM:PFM:REP 251->332|PF00583|1.2e-07|24.6|69/83|Acetyltransf_1| RP:SCP:NREP 1 RP:SCP:REP 207->320|1b6bA|7e-08|18.9|106/168|d.108.1.1| HM:SCP:REP 1->357|1p0hA_|1.1e-29|23.6|292/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 111 OP:NHOMOORG 103 OP:PATTERN -------------------------------------------------------------------- --1-----------1---------1------1--------------------------------------------------------11111-11---2111-121112---------------11111111111--------1---1--------------------1------------------111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------111-------------111111-----22--------------------------------------------------1-----------11111111-2211-1-------------------------------11111-------------------------------1---------1-----------------------111-----------11-------------1----11-1--------------------------------------------------------------------------------1111111--11111111--11-1-11-------------------------------1----------------------------------------------------------1----------------------------------------------------------------------------1--------------------------1----------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 152 STR:RPRED 42.3 SQ:SECSTR ##############################################################################################################################################################################################################HHHHTccccccccccccccccTTTTTTHHHHHHHHHcGGGEEEEEETTEEEEEEEEEEEccccccTGGGGGEEcccTTccEEEEEEEEEGGGcTTccHHHHHHHHHHHHHHTcTccEEEEcEccccccccccHHHHTTTEEEEEEcccccTT# DISOP:02AL 1-1| PSIPRED cEEEEEcccHHHHHHHHHHHHHHcccccccccHHHHHHHHcccccccccccEEEEEEEEEccEEEEEEEEEEEccccccccEEEEEEEEEcHHHHHHHHHHHHHHHHHHccccEEEEccccccccccEEEEcccccccEEEcccccHHHHHHHHHcccccHHHHEEEEEEcccccccHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcccccHHEEEEEEEccEEEEEEEEcccHHHHHHccccccccccccccEEccEEEEEEcHHHHcccHHHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHccEEEEEEEEEEccc //