[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50378.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  91/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:223 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   68->183 PF09335 * SNARE_assoc 7.3e-17 31.9 116/123  
:HMM:PFM   32->85 PF06589 * CRA 0.00038 30.2 53/157  
:BLT:SWISS 22->221 YDJZ_ECOLI 2e-15 27.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50378.1 GT:GENE ABO50378.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 2036662..2037333 GB:FROM 2036662 GB:TO 2037333 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: cpe:CPE1564 hypothetical protein GB:PROTEIN_ID ABO50378.1 GB:DB_XREF GI:134052407 LENGTH 223 SQ:AASEQ MRKHPILLVIFFTVCFFYLWGNEVLNIFKIVFSSDIQKAVELIRTAGSKAVLISIFINVAISLMGVMPSVFLTGANLIIFGLNKGFLVSWAGEVIGAAISFLLYRWGITSVAKLSTEQWKLFKTINSLPPLKQTYFLFILRMAPFIPSGLINLFGAITSVSLLNFLIATTAGKFPALLLETAFSYHLITLGRNYIYVGISILIALLLYLGIKKEMRRLEKQYE GT:EXON 1|1-223:0| BL:SWS:NREP 1 BL:SWS:REP 22->221|YDJZ_ECOLI|2e-15|27.0|196/235| TM:NTM 5 TM:REGION 5->27| TM:REGION 50->72| TM:REGION 84->106| TM:REGION 140->162| TM:REGION 190->211| HM:PFM:NREP 2 HM:PFM:REP 68->183|PF09335|7.3e-17|31.9|116/123|SNARE_assoc| HM:PFM:REP 32->85|PF06589|0.00038|30.2|53/157|CRA| OP:NHOMO 115 OP:NHOMOORG 91 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------222222222222222----11222121--11------11----------------------------------------------------------------------------------------------11112111111-----221----2---1-11-211---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------1----------------------------------------------------1--1111111111-1111111111111111111111----------------------1111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,221-224| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //