[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50392.1
DDBJ      :             succinate dehydrogenase subunit B
Swiss-Prot:             

Homologs  Archaea  48/68 : Bacteria  666/915 : Eukaryota  169/199 : Viruses  0/175   --->[See Alignment]
a.1.2d.15.4
:248 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->232 1kf6B PDBj 7e-23 27.5 %
:RPS:PDB   1->236 2bs2B PDBj 7e-22 26.6 %
:RPS:SCOP  1->110 1e7pB2  d.15.4.2 * 8e-10 27.2 %
:RPS:SCOP  114->236 1e7pB1  a.1.2.1 * 1e-26 29.3 %
:HMM:SCOP  1->110 2bs2B2 d.15.4.2 * 4.2e-22 31.1 %
:HMM:SCOP  111->242 1nekB1 a.1.2.1 * 1.2e-27 29.0 %
:HMM:PFM   151->165 PF00037 * Fer4 0.00068 46.7 15/24  
:BLT:SWISS 3->247 DHSB_BACSU 1e-97 64.5 %
:PROS 153->164|PS00198|4FE4S_FER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50392.1 GT:GENE ABO50392.1 GT:PRODUCT succinate dehydrogenase subunit B GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(2053905..2054651) GB:FROM 2053905 GB:TO 2054651 GB:DIRECTION - GB:PRODUCT succinate dehydrogenase subunit B GB:NOTE TIGRFAM: succinate dehydrogenase and fumarate reductase iron-sulfur protein KEGG: dsy:DSY0737 fumarate reductase iron-sulfur protein GB:PROTEIN_ID ABO50392.1 GB:DB_XREF GI:134052421 InterPro:IPR001450 InterPro:IPR004489 LENGTH 248 SQ:AASEQ MSKMVSLKIKRQSDVSTAAYWEEFMIPYKEKMNVISLLKEIQKNPVNAKGEATTPVVWECNCLEEVCGACTMLINGKARQACSALVDQLQQPIVLEPLSKFPLVRDLMVDRSIMFDHLKKVKAWIPIDGTYDLGPGLRMAQRVQEDSYPISRCMTCGCCLEACPNVNSKSKFIGPAPLAQVKLFNSHPTGAMNQEERLDAIMGVGGITDCGNAQNCVKVCPKQIPLAKTIAQLNRDTTIHGIKRWLGR GT:EXON 1|1-248:0| BL:SWS:NREP 1 BL:SWS:REP 3->247|DHSB_BACSU|1e-97|64.5|245/253| PROS 153->164|PS00198|4FE4S_FER_1|PDOC00176| BL:PDB:NREP 1 BL:PDB:REP 2->232|1kf6B|7e-23|27.5|222/243| RP:PDB:NREP 1 RP:PDB:REP 1->236|2bs2B|7e-22|26.6|229/239| HM:PFM:NREP 1 HM:PFM:REP 151->165|PF00037|0.00068|46.7|15/24|Fer4| RP:SCP:NREP 2 RP:SCP:REP 1->110|1e7pB2|8e-10|27.2|103/106|d.15.4.2| RP:SCP:REP 114->236|1e7pB1|1e-26|29.3|123/133|a.1.2.1| HM:SCP:REP 1->110|2bs2B2|4.2e-22|31.1|103/0|d.15.4.2|1/1|2Fe-2S ferredoxin-like| HM:SCP:REP 111->242|1nekB1|1.2e-27|29.0|131/0|a.1.2.1|1/1|alpha-helical ferredoxin| OP:NHOMO 1181 OP:NHOMOORG 883 OP:PATTERN 11-1-11111111111111111-11111111111111-11111---11-----1-------1111-11 -2-131--------22233-321122333332222221331221121-1111111111--112222233211111111-112121222--111------11--11-1-1-11111111111111111111211132--------111111111-1--111---1211111--11----1----11111---1111111111111111111111111111111111------1111111111111111111111---------------------------------------------------------------------------------------11---------2--1111-12---2---------11111111111121111111111111111111111-11111212111111111111111111111121212211111111111111-11111121111111111111111111111111111111-111121221212222244122222-2121111111231111111111222121-1-211111111111212-111-111121222-1-1121-1111-111-31221122221111111111122223--221-1-111122333313222232222322--11121------22222212222222222-2212222222222222222222222222222222222222222222222221122222222222211111111111111111-1111111111111111111111111111111111111111111111111111112222222222222211111111111111--1-111111----------------------------------------------11- 11--111-1---1111111111111111111111111111111-1-11111111111-1111111111112111111--111111111-1-1111111111-1212-11-1242211-11-12111131141-1121--111-1--1--11111-1-11-2311111211211111111K11-1112611361122121 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 237 STR:RPRED 95.6 SQ:SECSTR cccEEEEEEEETTcTTcccEEEEEEEEccTTccHHHHHHHHHHHccEEHHHTcTTcccccccccccccTTEEEETTEEEEGGGccGGGcTcEEEEEccTTcEEEETTEEEcHHHHHHHHHHTTccccccccccTTcccccHHHHHHHHHHHTcccccHHHHTcHHHHHcTTccHHHHHHHHHHHHTcTTccccHHHHHHHHccTTTGGGcccccHHHHHcTTcccHHHHHHHHHHHT########### DISOP:02AL 1-1,248-249| PSIPRED cccEEEEEEEEEccccccccEEEEEEEccccccHHHHHHHHHHHHHccccccccccEEccccccccccccEEEEccEEccccEEEHHHccccEEEEEcccccEEEEEccccHHHHHHHHHcccEEcccccccccccccccHHHHHHHHHHHHHHHccccHHHccccccccccccHHHHHHHHHHHccccccccHHHHHHHHccccccccccccccHHHHccccccHHHHHHHHHHHHHHHHHHHHHcc //